{[ promptMessage ]}

Bookmark it

{[ promptMessage ]}

L0610ap - GIIGA 485 amino acids Secondary structure...

Info iconThis preview shows pages 1–9. Sign up to view the full content.

View Full Document Right Arrow Icon
Click to edit Master subtitle style 2/10/11 “The free-energy change for a reaction determines whether it can occur” p. 91
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
2/10/11
Background image of page 2
2/10/11
Background image of page 3

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
2/10/11
Background image of page 4
2/10/11
Background image of page 5

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
2/10/11 Primary structure of yeast hexokinase 1 (Hxk1p) MVHLGPKKPQARKGSMADVPKELMDEIHQLEDMFTVDSET LRKVVKHFIDELNKGLTKKGGNIPMIPGWVMEFPTGKESG NYLAIDLGGTNLRVVLVKLSGNHTFDTTQSKYKLPHDMRT TKHQEELWSFIADSLKDFMVEQELLNTKDTLPLGFTFSYP ASQNKINEGILQRWTKGFDIPNVEGHDVVPLLQNEISKRE LPIEIVALINDTVGTLIASYYTDPETKMGVIFGTGVNGAF YDVVSDIEKLEGKLADDIPSNSPMAINCEYGSFDNEHLVL PRTKYDVAVDEQSPRPGQQAFEKMTSGYYLGELLRLVLLE
Background image of page 6
Background image of page 7

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
Background image of page 8
Background image of page 9
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: LNEKGLMLKDQDLSKLKQPYIMDTSYPARIEDDPFENLED TDDIFQKDFGVKTTLPERKLIRRLCELIGTRAARLAVCGI AAICQKRGYKTGHIAADGSVYNKYPGFKEAAAKGLRDIYG WTGDASKDPITIVPAEDGSGAGAAVIAALSEKRIAEGKSL GIIGA 485 amino acids 2/10/11 Secondary structure: arrangement of the peptide aa1-psi-peptide bond-phi-aa2 3D rotation Click to edit Master subtitle style 2/10/11 Secondary structure of yeast hexokinase alpha-helix Hx Click to edit Master subtitle style 2/10/11 Secondary structure of yeast hexokinase alpha-helix beta-sheet...
View Full Document

{[ snackBarMessage ]}

Page1 / 9

L0610ap - GIIGA 485 amino acids Secondary structure...

This preview shows document pages 1 - 9. Sign up to view the full document.

View Full Document Right Arrow Icon bookmark
Ask a homework question - tutors are online