L0610ap - GIIGA 485 amino acids Secondary structure...

Info iconThis preview shows pages 1–9. Sign up to view the full content.

View Full Document Right Arrow Icon
Click to edit Master subtitle style 2/10/11 “The free-energy change for a reaction determines whether it can occur” p. 91
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
2/10/11
Background image of page 2
2/10/11
Background image of page 3

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
2/10/11
Background image of page 4
2/10/11
Background image of page 5

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
2/10/11 Primary structure of yeast hexokinase 1 (Hxk1p) MVHLGPKKPQARKGSMADVPKELMDEIHQLEDMFTVDSET LRKVVKHFIDELNKGLTKKGGNIPMIPGWVMEFPTGKESG NYLAIDLGGTNLRVVLVKLSGNHTFDTTQSKYKLPHDMRT TKHQEELWSFIADSLKDFMVEQELLNTKDTLPLGFTFSYP ASQNKINEGILQRWTKGFDIPNVEGHDVVPLLQNEISKRE LPIEIVALINDTVGTLIASYYTDPETKMGVIFGTGVNGAF YDVVSDIEKLEGKLADDIPSNSPMAINCEYGSFDNEHLVL PRTKYDVAVDEQSPRPGQQAFEKMTSGYYLGELLRLVLLE
Background image of page 6
Background image of page 7

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 8
Background image of page 9
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: LNEKGLMLKDQDLSKLKQPYIMDTSYPARIEDDPFENLED TDDIFQKDFGVKTTLPERKLIRRLCELIGTRAARLAVCGI AAICQKRGYKTGHIAADGSVYNKYPGFKEAAAKGLRDIYG WTGDASKDPITIVPAEDGSGAGAAVIAALSEKRIAEGKSL GIIGA 485 amino acids 2/10/11 Secondary structure: arrangement of the peptide aa1-psi-peptide bond-phi-aa2 3D rotation Click to edit Master subtitle style 2/10/11 Secondary structure of yeast hexokinase alpha-helix Hx Click to edit Master subtitle style 2/10/11 Secondary structure of yeast hexokinase alpha-helix beta-sheet...
View Full Document

This note was uploaded on 02/09/2011 for the course BIOS 20182 taught by Professor Lahn during the Spring '11 term at UChicago.

Page1 / 9

L0610ap - GIIGA 485 amino acids Secondary structure...

This preview shows document pages 1 - 9. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online