UM_ks32c50100 - .6&5,6&0,&52&21752//(5...

Info iconThis preview shows pages 1–3. Sign up to view the full content.

View Full Document Right Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: .6&5,6&0,&52&21752//(5 352'8&729(59,(: 3UHOLPLQDU\9(5 0DUFK 86(560$18$/ .6& %,75,6& 0LFUR&RQWUROOHU (PEHGGHG1HWZRUN&RQWUROOHU 7KLVGRFXPHQWLVLQWHQGHGIRULQWHUQDOGLVWULEXWLRQDQGUHYLHZE\ 6DPVXQJ(OHFWURQLFVSHUVRQQHORQO\ 3OHDVHUHSRUWDQ\HUURUVRURPLVVLRQWRWKH6\VWHP0&8WHDPDW .LKHXQJ.RUHDIDFLOLW\ 7HO(0DLOMZ&+2,#VHFVDPVXQJFRP ,03257$17127,&( 352'8&729(59,(: .6&5,6&0,&52&21752//(5 352'8&729(59,(: ,1752'8&7,21 6DPVXQJV.6&ELW5,6&PLFURFRQWUROOHULVDFRVWHIIHFWLYHKLJKSHUIRUPDQFHPLFURFRQWUROOHU VROXWLRQIRU(WKHUQHWEDVHGV\VWHPV$QLQWHJUDWHG(WKHUQHWFRQWUROOHUWKH.6&LVGHVLJQHGIRUXVHLQ PDQDJHGFRPPXQLFDWLRQKXEVDQGURXWHUV 7KH.6&LVEXLOWDURXQGDQRXWVWDQGLQJ&38FRUHWKHELW$507'0,5,6&SURFHVVRUGHVLJQHGE\ $GYDQFHG5,6&0DFKLQHV/WG7KH$507'0,FRUHLVDORZSRZHUJHQHUDOSXUSRVHPLFURSURFHVVRUPDFURFHOO WKDWZDVGHYHORSHGIRUXVHLQDSSOLFDWLRQVSHFLILFDQGFXVWRPVSHFLILFLQWHJUDWHGFLUFXLWV,WVVLPSOHHOHJDQWDQG IXOO\VWDWLFGHVLJQLVSDUWLFXODUO\VXLWDEOHIRUFRVWVHQVLWLYHDQGSRZHUVHQVLWLYHDSSOLFDWLRQV 7KH.6&RIIHUVDFRQILJXUDEOH.E\WHXQLILHGFDFKH65$0DQG(WKHUQHWFRQWUROOHUZKLFKUHGXFHVWRWDO V\VWHPFRVW0RVWRIWKHRQFKLSIXQFWLRQEORFNVKDYHEHHQGHVLJQHGXVLQJDQ+'/V\QWKHVL]HUDQGWKH .6&KDVEHHQIXOO\YHULILHGLQ6DPVXQJVVWDWHRIWKHDUW$6,&WHVWHQYLURQPHQW ,PSRUWDQWSHULSKHUDOIXQFWLRQVLQFOXGHWZR+'/&FKDQQHOVZLWKEXIIHUGHVFULSWRUWZR8$57FKDQQHOVFKDQQHO *'0$WZRELWWLPHUVDQGSURJUDPPDEOH,2SRUWV2QERDUGORJLFLQFOXGHVDQLQWHUUXSWFRQWUROOHU'5$0 6'5$0FRQWUROOHUDQGDFRQWUROOHUIRU52065$0DQGIODVKPHPRU\7KH6\VWHP0DQDJHULQFOXGHVDQLQWHUQDO ELWV\VWHPEXVDUELWHUDQGDQH[WHUQDOPHPRU\FRQWUROOHU 7KHIROORZLQJLQWHJUDWHGRQFKLSIXQFWLRQVDUHGHVFULEHGLQGHWDLOLQWKLVXVHUVPDQXDO .E\WHXQLILHGFDFKH65$0 ,&LQWHUIDFH (WKHUQHWFRQWUROOHU +'/& *'0$ 8$57 7LPHUV 3URJUDPPDEOH,2SRUWV ,QWHUUXSWFRQWUROOHU 352'8&729(59,(: .6&5,6&0,&52&21752//(5 )($785(6 $UFKLWHFWXUH ,QWHJUDWHGV\VWHPIRUHPEHGGHGHWKHUQHW DSSOLFDWLRQV )XOO\ELW5,6&DUFKLWHFWXUH /LWWOH%LJ(QGLDQPRGHVXSSRUWHGEDVLFDOO\WKH LQWHUQDODUFKLWHFWXUHLVELJHQGLDQ 6RWKHOLWWOHHQGLDQPRGHRQO\VXSSRUWIRU H[WHUQDOPHPRU\ (IILFLHQWDQGSRZHUIXO$507'0,FRUH &RVWHIIHFWLYH-7$*EDVHGGHEXJVROXWLRQ %RXQGDU\VFDQ 'DWDDOLJQPHQWORJLF (QGLDQWUDQVODWLRQ 0ELWSHUVHFRQGRSHUDWLRQ )XOOFRPSOLDQFHZLWK,(((VWDQGDUG 0,,DQGZLUH0ESVLQWHUIDFH 6WDWLRQPDQDJHPHQWVLJQDOLQJ 2QFKLS&$0XSWRGHVWLQDWLRQDGGUHVVHV )XOOGXSOH[PRGHZLWK3$86(IHDWXUH /RQJVKRUWSDFNHWPRGHV 3$'JHQHUDWLRQ 6\VWHP0DQDJHU ELWH[WHUQDOEXVVXSSRUWIRU52065$0 IODVKPHPRU\'5$0DQGH[WHUQDO,2 2QHH[WHUQDOEXVPDVWHUZLWKEXVUHTXHVW DFNQRZOHGJHSLQV 6XSSRUWIRU('2QRUPDORU6'5$0 3URJUDPPDEOHDFFHVVF\FOHZDLWF\FOHV )RXUZRUGGHSWKZULWHEXIIHU &RVWHIIHFWLYHPHPRU\WRSHULSKHUDO'0$ LQWHUIDFH +'/&V +'/&SURWRFROIHDWXUHV )ODJGHWHFWLRQDQGV\QFKURQL]DWLRQ =HURLQVHUWLRQDQGGHOHWLRQ ,GOHGHWHFWLRQDQGWUDQVPLVVLRQ )&6JHQHUDWLRQDQGGHWHFWLRQELW $ERUWGHWHFWLRQDQGWUDQVPLVVLRQ $GGUHVVVHDUFKPRGHH[SDQGDEOHWRE\WHV 6HOHFWDEOH&5&RU1R&5&PRGH $XWRPDWLF&5&JHQHUDWRUSUHVHW 'LJLWDO3//EORFNIRUFORFNUHFRYHU\ %DXGUDWHJHQHUDWRU 15=15=,)00DQFKHVWHUGDWDIRUPDWVIRU7[5[ /RRSEDFNDQGDXWRHFKRPRGHV 7[5[),)2VKDYHZRUGuELWGHSWK 6HOHFWDEOHZRUGRUZRUGGDWDWUDQVIHUPRGH 'DWDDOLJQPHQWORJLF (QGLDQWUDQVODWLRQ 3URJUDPPDEOHLQWHUUXSWV 0RGHPLQWHUIDFH 8SWR0ESVRSHUDWLRQ +'/&IUDPHOHQJWKEDVHGRQRFWHWV FKDQQHO'0$EXIIHUGHVFULSWRUIRU7[5[RQ HDFK+'/& 8QLILHG,QVWUXFWLRQ'DWD&DFKH 7ZRZD\VHWDVVRFLDWLYHXQLILHG.E\WHFDFKH 6XSSRUWIRU/58OHDVWUHFHQWO\XVHGSURWRFRO &DFKHLVFRQILJXUDEOHDVDQLQWHUQDO65$0 ,&6HULDO,QWHUIDFH 0DVWHUPRGHRSHUDWLRQRQO\ %DXGUDWHJHQHUDWRUIRUVHULDOFORFNJHQHUDWLRQ (WKHUQHW&RQWUROOHU '0$HQJLQHZLWKEXUVWPRGH '0$7[5[EXIIHUVE\WHV7[E\WHV5[ 0$&7[5[),)2EXIIHUVE\WHV7[E\WHV 5[ .6&5,6&0,&52&21752//(5 352'8&729(59,(: '0$&RQWUROOHU FKDQQHO*HQHUDO'0$IRUPHPRU\WRPHPRU\ PHPRU\WR8$578$57WRPHPRU\GDWD WUDQVIHUVZLWKRXW&38LQWHUYHQWLRQ ,QLWLDWHGE\DVRIWZDUHRUH[WHUQDO'0$UHTXHVW ,QFUHPHQWVRUGHFUHPHQWVDVRXUFHRUGHVWLQDWLRQ DGGUHVVLQELWELWRUELWGDWDWUDQVIHUV GDWDEXUVWPRGH 3URJUDPPDEOH,2 SURJUDPPDEOH,2SRUWV 3LQVLQGLYLGXDOO\FRQILJXUDEOHWRLQSXWRXWSXWRU ,2PRGHIRUGHGLFDWHGVLJQDOV ,QWHUUXSW&RQWUROOHU LQWHUUXSWVRXUFHVLQFOXGLQJH[WHUQDOLQWHUUXSW VRXUFHV 1RUPDORUIDVWLQWHUUXSWPRGH,54),4 3ULRULWL]HGLQWHUUXSWKDQGOLQJ 8$57V 7ZR8$57VHULDO,2EORFNVZLWK'0$EDVHGRU LQWHUUXSWEDVHGRSHUDWLRQ 6XSSRUWIRUELWELWELWRUELWVHULDOGDWD WUDQVPLWDQGUHFHLYH 3URJUDPPDEOHEDXGUDWHV RUVWRSELWV 2GGRUHYHQSDULW\ %UHDNJHQHUDWLRQDQGGHWHFWLRQ 3DULW\RYHUUXQDQGIUDPLQJHUURUGHWHFWLRQ uFORFNPRGH ,QIUDUHG,57[5[VXSSRUW,U'$ 3// 7KHH[WHUQDOFORFNFDQEHPXOWLSOLHGE\RQFKLS 3//WRSURYLGHKLJKIUHTXHQF\V\VWHPFORFN 7KHLQSXWIUHTXHQF\UDQJHLV0+] 7KHRXWSXWIUHTXHQF\LVWLPHVRILQSXWFORFN7R JHW0+]LQSXWFORFNIUHTXHQF\VKRXOGEH 0+] 2SHUDWLQJ9ROWDJH5DQJH 9` 7LPHUV 7ZRSURJUDPPDEOHELWWLPHUV ,QWHUYDOPRGHRUWRJJOHPRGHRSHUDWLRQ 2SHUDWLQJ)UHTXHQF\ 8SWR0+] .6&5,6&0,&52&21752//(5 352'8&729(59,(: $507'0, %LW5,6&&38 ,&( %UHDNHU %LW 6\VWHP %XV &38,QWHUIDFH %DQN 520 65$0 )/$6+ %DQN '5$0 %DQN ([WHUQDO ,2 'HYLFH ([W%XV 5(4$&. ([WHUQDO %XV 0DVWHU .E\WH 8QLILHG &DFKH 0HPRU\ &RQWUROOHU ZLWK 5HIUHVK &RQWURO :RUG :ULWH %XIIHU 6\VWHP %XV $UELWHU %XV5RXWHU 6&/ 6'$ ,23RUWVLQFOXGLQJ ([W,17UHT 7LPHURXW ([W'0$5(4 ([W'0$$&. &RQVROH &KDQQHO+'/&V ZLWK'0$V (WKHUQHW&RQWUROOHU &KDQQHO%'0$ 5HPRWH 3RUW$% , & *HQHUDO,23RUWV ,QWHUUXSW&RQWUROOHU 8$57 %LW7LPHU *'0$ %'0$5$0V 7[%XIIHU%\WHV 5[%XIIHU%\WHV &$0%\WHV 0$& 7[),)2%\WHV 5[),)2%\WHV 7$3&RQWUROOHUIRU-7$* 0,,RU ZLUH ;WDO 2VF 3// )LJXUH.6&%ORFN'LDJUDP 352'8&729(59,(: .6&5,6&0,&52&21752//(5 966 9'' 8$5;' Q8$'65 8$7;' Q8$'75 8$5;' 6'$ 6&/ 3!7287 966 9'' 3!7287 3!Q;'$&.! 3!Q;'$&.! 3!Q;'5(4! 3!Q;'5(4! 3![,15(4! 3![,15(4! 3![,15(4! 966 9'' 3![,15(4! 3! 3! 3! 3! 3! 3! 3! 966 9'' 3! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! 966 9'' ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! 966 9'' 9'' 966 Q8$'75 8$7;' Q8$'65 Q'75$ 5;'$ Q576$ 7;'$ Q&76$ 9'' 966 Q'&'$ 5;&$ Q6<1&$ 7;&$ Q'75% 57'% Q576% 7;'% 9'' 966 Q&76% Q'&'% 5;&% Q6<1&% 7;&% &56&56B0 5;B'9/,1.B0 5;'!5;'B0 9'' 966 5;'! 5;'! 5;'! 5;B(55 ;B&/.5;&/.B. &2/&2/B0 7;'!7;'B0 7;'!/223B0 9'' 966 7;'! 7;'! B(553&203B0 ;B&/.7;&/.B0 7;B(17;(1B0 0',2 /,77/( 0'& 9'' 966 .6& 4)3 966 9'' ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! 966 9'' ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! ;'$7$! $''5! $''5! $''5! $''5! 966 9'' $''5! $''5! $''5! $''5! $''5! $''5! $''5! $''5!$3 $''5! $''5! 966 9'' $''5! $''5! $''5! $''5! $''5! $''5! $''5! $''5! ([W0$&. ([W05(4 Q:%(!'40! 966 9'' 9''D 966D ),/7(5 9'' 966 7&. 706 7', 7' Q7567 702'( 8&/. 9'' 966 Q(&6! Q(&6! Q(&6! Q(&6! Q(:$,7 Q2( %26,=(! %26,=(! Q5&6! &/.2(1 6'&/.0&/.2 9'' 966 ;&/. 966 Q5(6(7 &/.6(/ Q5&6! Q5&6! Q5&6! Q5&6! Q5&6! Q6'&6!Q5$6! Q6'&6!Q5$6! Q6'&6!Q5$6! 9'' 966 Q6'&6!Q5$6! Q6'5$6Q&$6! Q6'&$6Q&$6! &.(Q&$6! Q&$6! Q':( '40Q:%(! '40Q:%(! '40Q:%(! 9'' 966 )LJXUH.6&3LQ$VVLJQPHQW'LDJUDP .6&5,6&0,&52&21752//(5 352'8&729(59,(: 6,*1$/'(6&5,37,216 7DEOH.6&6LJQDO'HVFULSWLRQV 6LJQDO ;&/. 3LQ1R 7\SH , 'HVFULSWLRQ .6&6\VWHP&ORFNVRXUFH,I&/.6(/LV/RZ3//RXWSXW FORFNLVXVHGDVWKH.6&LQWHUQDOV\VWHPFORFN,I&/.6(/ LV+LJK;&/.LVXVHGDVWKH.6&LQWHUQDOV\VWHPFORFN 6\VWHP&ORFN2XW0&/.2LVPRQLWRUHGDVWKHVDPHSKDVHRI LQWHUQDOV\VWHPFORFN0&/. 6'&/.LVV\VWHPFORFNIRU6'5$0 &ORFN6HOHFW:KHQ&/.6(/LVORZOHYHO3//RXWSXWFORFNFDQ EHXVHGDVWKHPDVWHUFORFN:KHQ&/.6(/LVKLJKOHYHOWKH ;&/.LVXVHGDVWKHPDVWHUFORFN 1RW5HVHWQ5(6(7LVWKHJOREDOUHVHWLQSXWIRUWKH.6& 72DOORZDV\VWHPUHVHWDQGIRULQWHUQDOGLJLWDOILOWHULQJQ5(6(7 PXVWEHKHOGWR/RZOHYHOIRUDWOHDVWPDVWHUFORFNF\FOHV5HIHU WR)LJXUH.6&UHVHWWLPLQJGLDJUDPIRUPRUHGHWDLOV DERXWUHVHWWLPLQJ &ORFN2XW(QDEOH'LVDEOH6HHWKHSLQGHVFULSWLRQIRU0&/.2 7HVW0RGH7KH702'(ELWVHWWLQJVDUHLQWHUSUHWHGDVIROORZV QRUPDORSHUDWLQJPRGH FKLSWHVWPRGH 7KLV702'(SLQDOVRFDQEHXVHGWRFKDQJH0)RI3// 7RJHW0+]0&/.LQWHUQDOV\VWHPFORFNIURP0+]H[WHUQDO LQSXWFORFNKLJKOHYHOVKRXOGEHDVVLJQHGWR702'(DQG ORZOHYHOWR&/.6(/WKHQ0)ZLOOEHFKDQJHGWR ,IWKH3//LVXVHGS)FDSDFLWRUVKRXOGEHFRQQHFWHGEHWZHHQ WKHSLQDQGDQDORJJURXG -7$*7HVW&ORFN7KH-7$*WHVWFORFNVKLIWVVWDWHLQIRUPDWLRQDQG WHVWGDWDLQWRDQGRXWRIWKH.6&GXULQJ-7$*WHVW RSHUDWLRQV -7$*7HVW0RGH6HOHFW7KLVSLQFRQWUROV-7$*WHVWRSHUDWLRQVLQ WKH.6&7KLVSLQLVLQWHUQDOO\FRQQHFWHGSXOOXS -7$*7HVW'DWD,Q7KH7',OHYHOLVXVHGWRVHULDOO\VKLIWWHVWGDWD DQGLQVWUXFWLRQVLQWRWKH.6&GXULQJ-7$*WHVWRSHUDWLRQV 7KLVSLQLVLQWHUQDOO\FRQQHFWHGSXOOXS -7$*7HVW'DWD2XW7KH7'2OHYHOLVXVHGWRVHULDOO\VKLIWWHVWGDWD DQGLQVWUXFWLRQVRXWRIWKH.6&GXULQJ-7$*WHVW RSHUDWLRQV -7$*1RW5HVHW$V\QFKURQRXVUHVHWRIWKH-7$*ORJLF 0&/.26'&/. 2 &/.6(/ , Q5(6(7 , &/.2(1 702'( , , ),/7(5 7&. $, , 706 7', , , 7'2 2 Q7567 , 352'8&729(59,(: .6&5,6&0,&52&21752//(5 7DEOH.6&6LJQDO'HVFULSWLRQV 6LJQDO $''5>@ $''5>@$3 3LQ1R 7\SH 2 'HVFULSWLRQ $GGUHVV%XV7KHELWDGGUHVVEXV$''5>@FRYHUVWKHIXOO 0ZRUGDGGUHVVUDQJHRIHDFK52065$0IODVKPHPRU\ '5$0DQGWKHH[WHUQDO,2EDQNV 7KHELWLQWHUQDODGGUHVVEXVXVHGWRJHQHUDWH'5$0DGGUHVV 7KHQXPEHURIFROXPQDGGUHVVELWVLQ'5$0EDQN FDQEHSURJUDPPHGELWWRELWVXVHE\'5$0&21 UHJLVWHUV $''5>@$3LVWKHDXWRSUHFKDUJHFRQWUROSLQ7KHDXWR SUHFKDUJHFRPPDQGLVLVVXHGDWWKHVDPHWLPHDVEXUVWUHDG RUEXUVWZULWHE\DVVHUWLQJKLJKRQ$''5>@$3 ([WHUQDOELGLUHFWLRQDOELW'DWD%XV7KH.6&GDWD EXVVXSSRUWVH[WHUQDOELWELWDQGELWEXVVL]HV ;'$7$>@ ,2 Q5$6>@ Q6'&6>@ Q&$6>@ Q&$6>@Q6'5$6 Q&$6>@Q6'&$6 Q&$6>@&.( 2 1RW5RZ$GGUHVV6WUREHIRU'5$07KH.6&VXSSRUWVXS WRIRXU'5$0EDQNV2QHQ5$6RXWSXWLVSURYLGHGIRUHDFKEDQN Q6'&6>@DUHFKLSVHOHFWSLQVIRU6'5$0 1RWFROXPQDGGUHVVVWUREHIRU'5$07KHIRXUQ&$6RXWSXWV LQGLFDWHWKHE\WHVHOHFWLRQVZKHQHQYHUD'5$0EDQNLVDFFHVVHG Q6'5$6LVURZDGGUHVVVWUREHVLJQDOIRU6'5$0/DWFKHV URZDGGUHVVHVRQWKHSRVLWLYHJRLQJHGJHRIWKH6'&/.ZLWK Q6'5$6ORZ(QDEOHURZDFFHVVDQGSUHFKDUJH Q6'&$6LVFROXPQDGGUHVVVWUREHIRU6'5$0/DWFKHVFROXPQ DGGUHVVHVRQWKHSRVLWLYHJRLQJHGJHRIWKH6'&/. ZLWKQ6'&$6ORZ(QDEOHVFROXPQDFFHVV &.(LVFORFNHQDEOHVLJQDOIRU6'5$00DVNV6'5$0 V\VWHPFORFN6'&/.WRIUHH]HRSHUDWLRQIURPWKHQH[WFORFN F\FOH6'&/.VKRXOGEHHQDEOHGDWOHDVWRQHF\FOHSULRUWR QHZFRPPDQG'LVDEOHLQSXWEXIIHUVRI6'5$0IRUSRZHU GRZQLQVWDQGE\ '5$01RW:ULWH(QDEOH7KLVSLQLVSURYLGHGIRU'5$0EDQNZULWH RSHUDWLRQVQ:%(>@LVXVHGIRUZULWHRSHUDWLRQVWRWKH520 65$0IODVKPHPRU\EDQNV 1RW([WHUQDO,2&KLS6HOHFW)RXUH[WHUQDO,2EDQNVDUHSURYLGHG IRUH[WHUQDOPHPRU\PDSSHG,2RSHUDWLRQV(DFK,2EDQNVWRUHV XSWR.E\WHVQ(&6VLJQDOVLQGLFDWHZKLFKRIWKHIRXUH[WHUQDO ,2EDQNVLVVHOHFWHG 1RW([WHUQDO:DLW7KLVVLJQDOLVDFWLYDWHGZKHQDQH[WHUQDO,2 GHYLFHRU52065$0IODVKEDQNQHHGVPRUHDFFHVVF\FOHVWKDQ WKRVHGHILQHGLQWKHFRUUHVSRQGLQJFRQWUROUHJLVWHU 1RW52065$0)ODVK&KLS6HOHFW7KH.6&FDQDFFHVV XSWRVL[H[WHUQDO52065$0)ODVKEDQNV%\FRQWUROOLQJWKH Q5&6VLJQDOV\RXFDQPDS&38DGGUHVVHVLQWRWKHSK\VLFDO PHPRU\EDQNV 2 Q':( 2 Q(&6>@ 2 Q(:$,7 , Q5&6>@ 2 .6&5,6&0,&52&21752//(5 352'8&729(59,(: 7DEOH.6&6LJQDO'HVFULSWLRQV 6LJQDO %6,=(>@ 3LQ1R 7\SH , 'HVFULSWLRQ %DQN'DWD%XV$FFHVV6L]H%DQNLVXVHGIRUWKHERRWSURJUDP <RXXVHWKHVHSLQVWRVHWWKHVL]HRIWKHEDQNGDWDEXVDVIROORZV RQHE\WH KDOIZRUG RQHZRUGDQG UHVHUYHG 1RW2XWSXW(QDEOH:KHQHYHUDPHPRU\DFFHVVRFFXUVWKHQ2( RXWSXWFRQWUROVWKHRXWSXWHQDEOHSRUWRIWKHVSHFLILFPHPRU\ GHYLFH 1RW:ULWH%\WH(QDEOH:KHQHYHUDPHPRU\ZULWHDFFHVVRFFXUV WKHQ:%(RXWSXWFRQWUROVWKHZULWHHQDEOHSRUWRIWKHVSHFLILF PHPRU\GHYLFHH[FHSWIRU'5$0)RU'5$0EDQNV&$6>@ DQGQ':(DUHXVHGIRUWKHZULWHRSHUDWLRQ '40LVGDWDLQSXWRXWSXWPDVNVLJQDOIRU6'5$0 ([WHUQDO%XV0DVWHU5HTXHVW$QH[WHUQDOEXVPDVWHUXVHVWKLVSLQ WRUHTXHVWWKHH[WHUQDOEXV:KHQLWDFWLYDWHVWKH([W05(4VLJQDO WKH.6&GULYHVWKHVWDWHRIH[WHUQDOEXVSLQVWRKLJK LPSHGDQFH7KLVOHWVWKHH[WHUQDOEXVPDVWHUWDNHFRQWURORIWKH H[WHUQDOEXV:KHQLWKDVWKHFRQWUROWKHH[WHUQDOEXVPDVWHU DVVXPHVUHVSRQVLELOLW\IRU'5$0UHIUHVKRSHUDWLRQV7KH ([W05(4VLJQDOLVGHDFWLYDWHGZKHQWKHH[WHUQDOEXVPDVWHU UHOHDVHVWKHH[WHUQDOEXV:KHQWKLVRFFXUV([W0$&.JRHV/RZ OHYHODQGWKH.6&DVVXPHVWKHFRQWURORIWKHEXV ([WHUQDO%XV$FNQRZOHGJH6HHWKH([W05(4SLQGHVFULSWLRQ 0DQDJHPHQW'DWD&ORFN7KHVLJQDOOHYHODWWKH0'&SLQLVXVHG DVDWLPLQJUHIHUHQFHIRUGDWDWUDQVIHUVWKDWDUHFRQWUROOHGE\WKH 0',2VLJQDO 0DQDJHPHQW'DWD,2:KHQDUHDGFRPPDQGLVEHLQJH[HFXWHG GDWDWKDWLVFORFNHGRXWRIWKH3+<LVSUHVHQWHGRQWKLVSLQ:KHQD ZULWHFRPPDQGLVEHLQJH[HFXWHGGDWDWKDWLVFORFNHGRXWRIWKH FRQWUROOHULVSUHVHQWHGRQWKLVSLQIRUWKH3K\VLFDO/D\HU(QWLW\3+< /LWWOHHQGLDQPRGHVHOHFWSLQ,I/,77/(LV+LJK.6& RSHUDWHLQOLWWOHHQGLDQPRGH,I/RZWKHQLQ%LJHQGLDQ PRGH'HIDXOWYDOXHLVORZEHFDXVHWKLVSLQLVSXOOGRZQHG LQWHUQDOO\ &ROOLVLRQ'HWHFWHG&ROOLVLRQ'HWHFWHGIRU0&2/LVDVVHUWHG DV\QFKURQRXVO\ZLWKPLQLPXPGHOD\IURPWKHVWDUWRIDFROOLVLRQRQ WKHPHGLXPLQ0,,PRGH&2/B0LVDVVHUWHGZKHQD0ELWV 3+<GHWHFWVDFROOLVLRQ 7UDQVPLW&ORFN7UDQVPLW&ORFNIRU07KHFRQWUROOHUGULYHV 7;'>@DQG7;B(1IURPWKHULVLQJHGJHRI7;B&/.,Q0,,PRGH WKH3+<VDPSOHV7;'>@DQG7;B(1RQWKHULVLQJHGJHRI 7;B&/.)RUGDWDWUDQVIHUV7;&/.B0LVSURYLGHGE\WKH 0ELWV3+< Q2( 2 Q:%(>@ '40>@ 2 ([W05(4 , ([W0$&. 0'& 2 2 0',2 ,2 /,77/( , &2/&2/B0 , 7;B&/. 7;&/.B0 , 352'8&729(59,(: .6&5,6&0,&52&21752//(5 7DEOH.6&6LJQDO'HVFULSWLRQV 6LJQDO 7;'>@ /223B0 7;'B0 3LQ1R 7\SH 2 'HVFULSWLRQ 7UDQVPLW'DWD7UDQVPLW'DWDIRU0/RRSEDFNIRU07UDQVPLW GDWDLVDOLJQHGRQQLEEOHERXQGDULHV7;'>@FRUUHVSRQGVWRWKH ILUVWELWWREHWUDQVPLWWHGRQWKHSK\VLFDOPHGLXPZKLFKLVWKH/6% RIWKHILUVWE\WHDQGWKHILIWKELWRIWKDWE\WHGXULQJWKHQH[WFORFN 7;'B0LVVKDUHGZLWK7;'>@DQGLVDGDWDOLQHIRUWUDQVPLWWLQJWR WKH0ELWV3+</223B0LVVKDUHGZLWK7;'>@DQGLVGULYHQ E\WKHORRSEDFNELWLQWKHFRQWUROUHJLVWHU 7UDQVPLW(QDEOH7UDQVPLW(QDEOHIRU07;B(1SURYLGHVSUHFLVH IUDPLQJIRUWKHGDWDFDUULHGRQ7;'>@7KLVSLQLVDFWLYHGXULQJ WKHFORFNSHULRGVLQZKLFK7;'>@FRQWDLQVYDOLGGDWDWREH WUDQVPLWWHGIURPWKHSUHDPEOHVWDJHWKURXJK&5&:KHQWKH FRQWUROOHULVUHDG\WRWUDQVIHUGDWDLWDVVHUWV7;(1B0 7UDQVPLW(UURU3DFNHW&RPSUHVVLRQ(QDEOHIRU07;B(55LV GULYHQV\QFKURQRXVO\WR7;B&/.DQGVDPSOHGFRQWLQXRXVO\E\WKH 3K\VLFDO/D\HU(QWLW\3+<,IDVVHUWHGIRURQHRUPRUH7;B&/. SHULRGV7;B(55FDXVHVWKH3+<WRHPLWRQHRUPRUHV\PEROV ZKLFKDUHQRWSDUWRIWKHYDOLGGDWDRUGHOLPLWHUVHWORFDWHG VRPHZKHUHLQWKHIUDPHWKDWLVEHLQJWUDQVPLWWHG3&203B0LV DVVHUWHGLPPHGLDWHO\DIWHUWKHSDFNHWV'$ILHOGLVUHFHLYHG 3&203B0LVXVHGZLWKWKH0DQDJHPHQW%XVRIWKH'3 5HSHDWHU,QWHUIDFH&RQWUROOHUIURP1DWLRQDO6HPLFRQGXFWRU7KH 0$&FDQEHSURJUDPPHGWRDVVHUW3&203LIWKHUHLVD&$0 PDWFKRULIWKHUHLVQRWDPDWFK7KH5,&5HSHDWHU,QWHUIDFH &RQWUROOHUXVHVWKLVVLJQDOWRFRPSUHVVVKRUWHQWKHSDFNHW UHFHLYHGIRUPDQDJHPHQWSXUSRVHVDQGWRUHGXFHPHPRU\XVDJH 6HHWKH'3'DWD6KHHWSXEOLVKHGE\1DWLRQDO 6HPLFRQGXFWRUIRUGHWDLOVRQWKH5,&0DQDJHPHQW%XV 7KLVSLQLVFRQWUROOHGE\DVSHFLDOUHJLVWHUZLWKZKLFK\RXFDQ GHILQHWKHSRODULW\DQGDVVHUWLRQPHWKRG&$0PDWFKDFWLYHRUQRW PDWFKDFWLYHRIWKH3&203VLJQDO &DUULHU6HQVH&DUULHU6HQVHIRU0&56LVDVVHUWHG DV\QFKURQRXVO\ZLWKPLQLPXPGHOD\IURPWKHGHWHFWLRQRIDQRQ LGOHPHGLXPLQ0,,PRGH&56B0LVDVVHUWHGZKHQD0ELWV 3+<KDVGDWDWRWUDQVIHU$0ELWVWUDQVPLVVLRQDOVRXVHVWKLV VLJQDO 5HFHLYH&ORFN5HFHLYH&ORFNIRU05;B&/.LVDFRQWLQXRXV FORFNVLJQDO,WVIUHTXHQF\LV0+]IRU0ELWVRSHUDWLRQDQG 0+]IRU0ELWV5;'>@5;B'9DQG5;B(55DUHGULYHQ E\WKH3+<RIIWKHIDOOLQJHGJHRI5;B&/.DQGVDPSOHGRQWKH ULVLQJHGJHRI5;B&/.7RUHFHLYHGDWDWKH7;&/.B0FORFN FRPHVIURPWKH0ELWV3+< 5HFHLYH'DWD5HFHLYH'DWDIRU05;'LVDOLJQHGRQQLEEOH ERXQGDULHV5;'>@FRUUHVSRQGVWRWKHILUVWELWUHFHLYHGRQWKH SK\VLFDOPHGLXPZKLFKLVWKH/6%RIWKHE\WHLQRQHFORFNSHULRG DQGWKHILIWKELWRIWKDWE\WHLQWKHQH[WFORFN5;'B0LVVKDUHG ZLWK5;'>@DQGLWLVDOLQHIRUUHFHLYLQJGDWDIURPWKH0ELWV 3+< 7;B(1 7;(1B0 2 7;B(55 3&203B0 2 &56&56B0 , 5;B&/. 5;&/.B0 , 5;'>@ 5;'B0 , .6&5,6&0,&52&21752//(5 352'8&729(59,(: 7DEOH.6&6LJQDO'HVFULSWLRQV 6LJQDO 5;B'9/,1.B0 3LQ1R 7\SH , 'HVFULSWLRQ 5HFHLYH'DWD9DOLG/LQN6WDWXVIRU03+<DVVHUWV5;B'9 V\QFKURQRXVO\KROGLQJLWDFWLYHGXULQJWKHFORFNSHULRGVLQZKLFK 5;'>@FRQWDLQVYDOLGGDWDUHFHLYHG3+<DVVHUWV5;B'9QRODWHU WKDQWKHFORFNSHULRGZKHQLWSODFHVWKHILUVWQLEEOHRIWKHVWDUW IUDPHGHOLPLWHU6)'RQ5;'>@,I3+<DVVHUWV5;B'9SULRUWR WKHILUVWQLEEOHRIWKH6)'WKHQ5;'>@FDUULHVYDOLGSUHDPEOH V\PEROV/,1.B0LVVKDUHGZLWK5;B'9DQGXVHGWRFRQYH\WKH OLQNVWDWXVRIWKH0ELWVHQGHF7KHYDOXHLVVWRUHGLQDVWDWXV UHJLVWHU 5HFHLYH(UURU3+<DVVHUWV5;B(55V\QFKURQRXVO\ZKHQHYHULW GHWHFWVDSK\VLFDOPHGLXPHUURUHJDFRGLQJYLRODWLRQ3+< DVVHUWV5;B(55RQO\ZKHQLWDVVHUWV5;B'9 +'/&&K$7UDQVPLW'DWD7KHVHULDORXWSXWGDWDIURPWKH WUDQVPLWWHULVFRGHGLQ15=15=,)00DQFKHVWHUGDWDIRUPDW +'/&&K$5HFHLYH'DWD7KHVHULDOLQSXWGDWDUHFHLYHGE\WKH GHYLFHVKRXOGEHFRGHGLQ15=15=,)00DQFKHVWHUGDWDIRUPDW 7KHGDWDUDWHVKRXOGQRWH[FHHGWKHUDWHRIWKH.6& LQWHUQDOPDVWHUFORFN +'/&&K$'DWD7HUPLQDO5HDG\Q'75$RXWSXWLQGLFDWHVWKDWWKH GDWDWHUPLQDOGHYLFHLVUHDG\IRUWUDQVPLVVLRQDQGUHFHSWLRQ +'/&&K$5HTXHVW7R6HQG7KHQ576$RXWSXWLVFRQWUROOHGE\ WKH7[5HTXHVWWR6HQGFRQWUROELW:KHQWKH7[576ELWVHWWR WKHQ576RXWSXWLVGULYHQ/RZ:KHQWKH7[576ELWFOHDUWRWKH Q576RXWSXWVWLOOUHPDLQV/RZXQWLOWKHIUDPHVHQWLVUHDFKHGWR HQGDQGWKHUHLVQRPRUHGDWDLQWKH7[),)2WRVHQGDQHZ IUDPH +'/&&K$&OHDU7R6HQG7KH.6&VWRUHVHDFK WUDQVLWLRQRIQ&76WRHQVXUHWKDWLWVRFFXUUHQFHZRXOGEH DFNQRZOHGJHGE\WKHV\VWHP +'/&&K$'DWD&DUULHU'HWHFWHG$+LJKOHYHORQWKLVSLQUHVHWV DQGLQKLELWVWKHUHFHLYHUUHJLVWHU'DWDIURPDSUHYLRXVIUDPHWKDW PD\UHPDLQLQWKH5[),)2LVUHWDLQHG7KH.6&VWRUHV HDFKWUDQVLWLRQRIQ'&' +'/&&K$6\QFLVGHWHFWHG7KLVLQGLFDWHVWKHUHFHSWLRQRIDIODJ 7KHQ6<1&RXWSXWJRHVORZIRURQHELWWLPHEHJLQQLQJDWWKHODVWELW RIWKHIODJ +'/&&K$5HFHLYHU&ORFN:KHQWKLVFORFNLQSXWLVXVHGDVWKH UHFHLYHUFORFNWKHUHFHLYHUVDPSOHVWKHGDWDRQWKHSRVLWLYHHGJH RI5;&$FORFN7KLVFORFNFDQEHWKHVRXUFHFORFNRIWKHUHFHLYHU WKHEDXGUDWHJHQHUDWRURUWKH'3// 5;B(55 , 7;'$ 5;'$ 2 , Q'75$ Q576$ 2 2 Q&76$ , Q'&'$ , Q6<1&$ 2 5;&$ , 352'8&729(59,(: .6&5,6&0,&52&21752//(5 7DEOH.6&6LJQDO'HVFULSWLRQV 6LJQDO 7;&$ 3LQ1R 7\SH ,2 'HVFULSWLRQ +'/&&K$7UDQVPLWWHU&ORFN:KHQWKLVFORFNLQSXWLVXVHGDVWKH WUDQVPLWWHUFORFNWKHWUDQVPLWWHUVKLIWVGDWDRQWKHQHJDWLYH WUDQVLWLRQRIWKH7;&$FORFN,I\RXGRQRWXVH7;&$DVWKH WUDQVPLWWHUFORFN\RXFDQXVHLWDVDQRXWSXWSLQIRUPRQLWRULQJ LQWHUQDOFORFNVVXFKDVWKHWUDQVPLWWHUFORFNUHFHLYHUFORFNDQG EDXGUDWHJHQHUDWRURXWSXWFORFNV +'/&&K%7UDQVPLW'DWD6HHWKH7;'$SLQGHVFULSWLRQ +'/&&K%5HFHLYH'DWD6HHWKH5;'$SLQGHVFULSWLRQ +'/&&K%'DWD7HUPLQDO5HDG\6HHWKHQ'75$SLQGHVFULSWLRQ +'/&&K%5HTXHVW7R6HQG6HHWKHQ576$SLQGHVFULSWLRQ +'/&&K%&OHDU7R6HQG6HHWKHQ&76$SLQGHVFULSWLRQ +'/&&K%'DWD&DUULHU'HWHFWHG6HHWKHQ'&'$SLQGHVFULSWLRQ +'/&&K%6\QFLVGHWHFWHG6HHWKHQ6<1&$SLQGHVFULSWLRQ +'/&&K%5HFHLYHU&ORFN6HHWKH5;&$SLQGHVFULSWLRQ +'/&&K%7UDQVPLWWHU&ORFN6HHWKH7;&$SLQGHVFULSWLRQ 7KHH[WHUQDO8$57FORFNLQSXW0&/.RU3//JHQHUDWHGFORFN FDQEHXVHGDVWKH8$57FORFN<RXFDQXVH8&/.ZLWKDQ DSSURSULDWHGLYLGHGE\IDFWRULIDYHU\SUHFLRXVEDXGUDWHFORFN LVUHTXLUHG 8$575HFHLYH'DWD5;'LVWKH8$57LQSXWVLJQDOIRU UHFHLYLQJVHULDOGDWD 8$577UDQVPLW'DWD7;'LVWKH8$57RXWSXWVLJQDOIRU WUDQVPLWWLQJVHULDOGDWD 1RW8$57'DWD7HUPLQDO5HDG\7KLVLQSXWVLJQDOVWKH .6&WKDWWKHSHULSKHUDORUKRVWLVUHDG\WRWUDQVPLWRU UHFHLYHVHULDOGDWD 1RW8$57'DWD6HW5HDG\7KLVRXWSXWVLJQDOVWKHKRVWRU SHULSKHUDOWKDW8$57LVUHDG\WRWUDQVPLWRUUHFHLYHVHULDOGDWD 8$575HFHLYH'DWD6HHWKH5;'SLQGHVFULSWLRQ 8$577UDQVPLW'DWD6HHWKH7;'SLQGHVFULSWLRQ 1RW8$57'DWD7HUPLQDO5HDG\6HHWKH'75SLQGHVFULSWLRQ 1RW8$57'DWD6HW5HDG\6HHWKH'65SLQGHVFULSWLRQ *HQHUDO,2SRUWV6HHWKH,2SRUWVFKDSWHU ([WHUQDOLQWHUUXSWUHTXHVWOLQHVRUJHQHUDO,2SRUWV 6HHWKH,2SRUWVFKDSWHU 1RW([WHUQDO'0$UHTXHVWVIRU*'0$RUJHQHUDO,2SRUWV 6HHWKH,2SRUWVFKDSWHU 7;'% 5;'% Q'75% Q576% Q&76% Q'&'% Q6<1&% 5;&% 7;&% 8&/. 2 , 2 2 , , 2 , ,2 , 8$5;' 8$7;' Q8$'75 , 2 , Q8$'65 8$5;' 8$7;' Q8$'75 Q8$'65 3>@ ;,175(4>@ 3>@ Q;'5(4>@ 3>@ 2 , 2 , 2 ,2 ,2 ,2 .6&5,6&0,&52&21752//(5 352'8&729(59,(: 7DEOH.6&6LJQDO'HVFULSWLRQV 6LJQDO Q;'$&.>@ 3>@ 72873>@ 72873>@ 6&/ 6'$ 9''3 3LQ1R 7\SH ,2 ,2 ,2 ,2 ,2 3RZHU 'HVFULSWLRQ 1RW([WHUQDO'0$DFNQRZOHGJHIURP*'0$RUJHQHUDO,2SRUWV 6HHWKH,2SRUWVFKDSWHU 7LPHURXWRUJHQHUDO,2SRUW6HHWKH,2SRUWVFKDSWHU 7LPHURXWRUJHQHUDO,2SRUW6HHWKH,2SRUWVFKDSWHU ,&VHULDOFORFN ,&VHULDOGDWD ,2SDGSRZHU 9'', 3RZHU ,QWHUQDOFRUHSRZHU 9663 *1' ,2SDGJURXQG 966, *1' ,QWHUQDOFRUHJURXQG 9''$ 966$9%%$ 3RZHU *1' $QDORJSRZHUIRU3// $QDORJ%XONJURXQGIRU3// 127(6 6'5$0RU('2QRUPDO'5$0LQWHUIDFHVLJQDOSLQVDUHVKDUHGIXQFWLRQV,WVIXQFWLRQVZLOOEHFRQILJXUHGE\6<6&)*>@ 7KHVHOHFWHGPRGHIRU0+]LQWHUQDOV\VWHPFORFNDUHSUHSDUHGWRWKHIXWXUH0+]RSHUDWLRQGHYLFH 352'8&729(59,(: .6&5,6&0,&52&21752//(5 7DEOH.6&3LQ/LVWDQG3$'7\SH *URXS 6\VWHP &RQILJXUDWLRQ 3LQ1DPH ;&/. 0&/.2 &/.6(/ Q5(6(7 &/.2(1 702'( /,77/( ),/7(5 7$3&RQWURO 7&. 706 7', 7'2 Q7567 0HPRU\ ,QWHUIDFH $''5>@ ;'$7$>@ Q5$6>@ Q&$6>@ Q':( Q(&6>@ Q(:$,7 Q5&6>@ %6,=(>@ Q2( Q:%(>@ ([W05(4 ([W0$&. 3LQ &RXQWV ,2 7\SH , 2 , , , , , , , , , 2 , 2 ,2 2 2 2 2 , 2 , 2 2 , 2 3DG7\SH SWLF SRE SWLF SWLV SWLF SWLF SWLFG SLDBEE SWLF SWLFX SWLFX SWRW SWLFX SWRW SWEVXW SRW SRW SRW SRW SWLF SRW SWLF SRW SRW SWLF SRE 'HVFULSWLRQ .6&V\VWHPVRXUFHFORFN 6\VWHPFORFNRXW &ORFNVHOHFW 1RWUHVHW &ORFNRXWHQDEOHGLVDEOH 7HVWPRGH /LWWOHHQGLDQPRGHVHOHFWSLQ 3//ILOWHUSLQ -7$*WHVWFORFN -7$*WHVWPRGHVHOHFW -7$*WHVWGDWDLQ -7$*WHVWGDWDRXW -7$*QRWUHVHW $GGUHVVEXV ([WHUQDOELGLUHFWLRQDOELWGDWDEXV 1RWURZDGGUHVVVWUREHIRU'5$0 1RWFROXPQDGGUHVVVWUREHIRU'5$0 1RWZULWHHQDEOH 1RWH[WHUQDO,2FKLSVHOHFW 1RWH[WHUQDOZDLWVLJQDO 1RW52065$0IODVKFKLSVHOHFW %DQNGDWDEXVDFFHVVVL]H 1RWRXWSXWHQDEOH 1RWZULWHE\WHHQDEOH ([WHUQDOPDVWHUEXVUHTXHVW ([WHUQDOEXVDFNQRZOHGJH .6&5,6&0,&52&21752//(5 352'8&729(59,(: 7DEOH.6&3LQ/LVWDQG3$'7\SH *URXS (WKHUQHW &RQWUROOHU 3LQ1DPH 0'& 0',2 &2/ &2/B0 7;B&/. 7;&/.B0 7;'>@ 7;'B0 /223B0 7;B(1 7;(1B0 7;B(55 3&203B0 &56 &56B0 5;B&/. 5;&/.B0 5;'>@ 5;'B0 5;B'9 /,1.B0 5;B(55 +'/& &KDQQHO$ 7;'$ 5;'$ Q'75$ Q576$ Q&76$ Q'&'$ Q6<1&$ 5;&$ 7;&$ 3LQ &RXQWV ,2 7\SH 2 ,2 , , 2 3DG7\SH SRE SWEFXW SWLV SWLV SRE 'HVFULSWLRQ 0DQDJHPHQWGDWDFORFN 0DQDJHPHQWGDWD,2 &ROOLVLRQGHWHFWHGFROOLVLRQGHWHFWHGIRU0 7UDQVPLWGDWDWUDQVPLWGDWDIRU0 7UDQVPLWGDWDWUDQVPLWGDWDIRU0 2 2 , , , , , 2 , 2 2 , , 2 , ,2 SRE SRE SWLV SWLV SWLV SWLV SWLV SRE SWLV SRE SRE SWLV SWLV SRE SWLV SWEVXW 7UDQVPLWHQDEOHRUWUDQVPLWHQDEOHIRU0 7UDQVPLWHUURUSDFNHWFRPSUHVVLRQHQDEOHIRU 0 &DUULHUVHQVHFDUULHUVHQVHIRU0 5HFHLYHFORFNUHFHLYHFORFNIRU0 5HFHLYHGDWDUHFHLYHGDWDIRU0 5HFHLYHGDWDYDOLG 5HFHLYHHUURU +'/&FKDQQHO$WUDQVPLWGDWD +'/&FKDQQHO$UHFHLYHGDWD +'/&FKDQQHO$GDWDWHUPLQDOUHDG\ +'/&FKDQQHO$UHTXHVWWRVHQG +'/&FKDQQHO$FOHDUWRVHQG +'/&FKDQQHO$GDWDFDUULHUGHWHFWHG +'/&FKDQQHO$V\QFLVGHWHFWHG +'/&FKDQQHO$UHFHLYHUFORFN +'/&FKDQQHO$WUDQVPLWWHUFORFN 352'8&729(59,(: .6&5,6&0,&52&21752//(5 7DEOH.6&3LQ/LVWDQG3$'7\SH *URXS +'/& &KDQQHO% 3LQ1DPH 7;'% 5;'% Q'75% Q576% Q&76% Q'&'% Q6<1&% 5;&% 7;&% 8$57 8&/. 8$5;' 8$7;' Q8$'75 Q8$'65 8$57 8$5;' 8$7;' Q8$'75 Q8$'65 *HQHUDO 3XUSRVH ,23RUWV [,175(4 Q;'5(4 Q;'$&. 7LPHU 3>@ [,175(4>@ 3>@ Q;'5(4>@ 3>@ Q;'$&.>@ 3>@ 7,0(53>@ 7,0(53>@ ,& 6&/ 6'$ 3LQ &RXQWV ,2 7\SH 2 , 2 2 , , 2 , ,2 , , 2 , 2 , 2 , 2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 3DG7\SH SRE SWLV SRE SRE SWLV SWLV SRE SWLV SWEVXW SWLV SWLF SRE SWLF SRE SWLF SRE SWLF SRE SWEVWVP SWEVWVP SWEVWVP SWEVWVP SWEVWVP SWEVWVP SWEFG SWEFG 'HVFULSWLRQ +'/&FKDQQHO%WUDQVPLWGDWD +'/&FKDQQHO%UHFHLYHGDWD +'/&FKDQQHO%GDWDWHUPLQDOUHDG\ +'/&FKDQQHO%UHTXHVWWRVHQG +'/&FKDQQHO%FOHDUWRVHQG +'/&FKDQQHO%GDWDFDUULHUGHWHFWHG +'/&FKDQQHO%V\QFLVGHWHFWHG +'/&FKDQQHO%UHFHLYHUFORFN +'/&FKDQQHO%WUDQVPLWWHUFORFN 8$57([WHUQDO&ORFNIRU8$578$57 8$57UHFHLYHGDWD 8$57WUDQVPLWGDWD 1RW8$57GDWDWHUPLQDOUHDG\ 1RW8$57GDWDVHWUHDG\ 8$57UHFHLYHGDWD 8$57WUDQVPLWGDWD 1RW8$57GDWDWHUPLQDOUHDG\ 1RW8$57GDWDVHWUHDG\ *HQHUDO,2SRUWV ([WHUQDOLQWHUUXSWUHTXHVWVRUJHQHUDO,2SRUWV ([WHUQDO'0$UHTXHVWVIRU*'0$RUJHQHUDO ,2SRUWV ([WHUQDO'0$DFNQRZOHGJHIURP*'0$RU JHQHUDO,2SRUWV 7LPHURXWRUJHQHUDO,2SRUW 7LPHURXWRUJHQHUDO,2SRUW ,&VHULDOFORFN ,&VHULDOGDWD .6&5,6&0,&52&21752//(5 352'8&729(59,(: 7DEOH.6&3$'7\SH 3DG 7\SH SWLF SWLV SWLFX SWLFG SLDBEE SRE SWRW SRE SWRW SWRW SWEVXW SWEFXW SWEFG ,2 7\SH , , , , , 2 2 2 2 2 ,2 ,2 ,2 &XUUHQW 'ULYH P$ P$ P$ P$ P$ P$ P$ P$ &HOO7\SH /9&026/HYHO /9&0266FKPLW 7ULJJHU/HYHO /9&026/HYHO /9&026/HYHO $QDORJLQSXWZLWK VHSHUDWHEXONELDV 1RUPDO%XIIHU 7ULVWDWH%XIIHU 1RUPDO%XIIHU 7ULVWDWH%XIIHU 7ULVWDWH%XIIHU /9&0266FKPLWWULJJHU OHYHO7ULVWDWH%XIIHU /9&026/HYHO 7ULVWDWH%XIIHU /9&026/HYHO 2SHQGUDLQ%XIIHU )HDWXUH 9WROHUDQW 9WROHUDQW 9WROHUDQW 3XOOXSUHJLVWHU 9WROHUDQW 3XOOGRZQUHJLVWHU 9WROHUDQW 9WROHUDQW 9WROHUDQW 9WROHUDQW 3XOOXSUHJLVWHU 9WROHUDQW 9WROHUDQW 6OHZ5DWH &RQWURO 0HGLXP 127( )RUGHWDLOLQIRUPDWLRQDERXWWKHSDGW\SHVHH&KDSWHU,QSXW2XWSXW&HOOVRIWKH67'0'/XP9 6WDQGDUG&HOO/LEUDU\'DWD%RRNSURGXFHGE\6DPVXQJ(OHFWURQLFV&R/WG$6,&7HDP Q5(6(7 I 0&/. I 0&/. Q5&6 127( $IWHUWKHIDOOLQJHGJHRIQ5(6(7WKH.6&FRXQWF\FOHVIRUD V\VHWHPUHVHWDQGQHHGVIXUWKHUF\FOHVIRUD7$*5$0FOHDURIFDFKH $IWHUWKHVHF\FOHVWKH.6&DVVHUWVQ5&6ZKHQWKHQ5(6(7LV UHOHDVHG )LJXUH5HVHW7LPLQJ'LDJUDPW 352'8&729(59,(: .6&5,6&0,&52&21752//(5 &38&25(29(59,(: 7KH.6&&38FRUHLVDJHQHUDOSXUSRVHELW$507'0,PLFURSURFHVVRUGHYHORSHGE\$GYDQFHG 5,6&0DFKLQHV/WG$507KHFRUHDUFKLWHFWXUHLVEDVHGRQ5HGXFHG,QVWUXFWLRQ6HW&RPSXWHU5,6& SULQFLSOHV7KH5,6&DUFKLWHFWXUHPDNHVWKHLQVWUXFWLRQVHWDQGLWVUHODWHGGHFRGLQJPHFKDQLVPVLPSOHUDQGPRUH HIILFLHQWWKDQWKRVHZLWKPLFURSURJUDPPHG&RPSOH[,QVWUXFWLRQ6HW&RPSXWHU&,6&V\VWHPV+LJKLQVWUXFWLRQ WKURXJKSXWDQGLPSUHVVLYHUHDOWLPHLQWHUUXSWUHVSRQVHDUHDPRQJWKHPDMRUEHQHLIWVRIWKHDUFKLWHFWXUH3LSHOLQLQJ LVDOVRHPSOR\HGVRWKDWDOOFRPSRQHQWVRIWKHSURFHVVLQJDQGPHPRU\V\VWHPVFDQRSHUDWHFRQWLQXRXVO\7KH $507'0,KDVDELWDGGUHVVEXV $QLPSRUWDQWIHDWXUHRIWKH$507'0,SURFHVVRUWKDWPDNHVLWVHOIGLVWLQFWIURPWKH$50SURFHVVRULVDXQLTXH DUFKLWHFWXUDOVWUDWHJ\FDOOHG7+80%7KH7+80%VWUDWHJ\LVDQH[WHQVLRQRIWKHEDVLF$50DUFKLWHFWXUH FRQVLVWLQJRILQVWUXFWLRQIRUPDWV7KHVHIRUPDWVDUHEDVHGRQWKHVWDQGDUGELW$50LQVWUXFWLRQVHWZKLOH KDYLQJEHHQUHFRGHGXVLQJELWZLGHRSFRGHV $V7+80%LQVWUXFWLRQVDUHRQHKDOIWKHELWZLGWKRIQRUPDO$50LQVWUXFWLRQVWKH\SURGXFHYHU\KLJKGHQVLW\ FRGHV:KHQD7+80%LQVWUXFWLRQLVH[HFXWHGLWVELWRSFRGHLVGHFRGHGE\WKHSURFHVVRULQWRLWVHTXLYDOHQW LQVWUXFWLRQLQWKHVWDQGDUG$50LQVWUXFWLRQVHW7KH$50FRUHWKHQSURFHVVHVWKHELWLQVWUXFWLRQDVLWZRXOGD QRUPDOELWLQVWUXFWLRQ,QRWKHUZRUGVWKH7+80%DUFKLWHFWXUHJLYHVELWV\VWHPVDZD\WRDFFHVVWKHELW SHUIRUPDQFHRIWKH$50FRUHZLWKRXWUHTXLULQJWKHIXOORYHUKHDGRIELWSURFHVVLQJ $VWKH$507'0,FRUHFDQH[HFXWHERWKVWDQGDUGELW$50LQVWUXFWLRQVDQGELW7+80%LQVWUXFWLRQVLW DOORZV\RXWRPL[WKHURXWLQHVRI7+80%LQVWUXFWLRQVDQG$50FRGHLQWKHVDPHDGGUHVVVSDFH,QWKLVZD\\RX FDQDGMXVWFRGHVL]HDQGSHUIRUPDQFHURXWLQHE\URXWLQHWRILQGWKHEHVWSURJUDPPLQJVROXWLRQIRUDVSHFLILF DSSOLFDWLRQ $''5(66 5(*,67(5 $''5(66 ,1&5(0(17(5 ,16758&7,21 '(&2'(5DQG /2*,&&21752/ 5(*,67(5%$1. 08/7,3/,(5 %$55(/ 6+,)7(5 %,7$/8 ,16758&7,21 3,3(/,1(DQG5($' '$7$5(*,67(5 :5,7('$7$ 5(*,67(5 )LJXUH$507'0,&RUH%ORFN'LDJUDP .6&5,6&0,&52&21752//(5 352'8&729(59,(: ,16758&7,216(7 7KH.6&LQVWUXFWLRQVHWLVGLYLGHGLQWRWZRVXEVHWVDVWDQGDUGELW$50LQVWUXFWLRQVHWDQGDELW 7+80%LQVWUXFWLRQVHW 7KHELW$50LQVWUXFWLRQVHWLVFRPSULVHGRIWKLUWHHQEDVLFLQVWUXFWLRQW\SHVZKLFKFDQLQWXUQEHGLYLGHGLQWR IRXUEURDGFODVVHV )RXUW\SHVRIEUDQFKLQVWUXFWLRQVZKLFKFRQWUROSURJUDPH[HFXWLRQIORZLQVWUXFWLRQSULYLOHJHOHYHOVDQG VZLWFKLQJEHWZHHQDQ$50FRGHDQGD7+80%FRGH 7KUHHW\SHVRIGDWDSURFHVVLQJLQVWUXFWLRQVZKLFKXVHWKHRQFKLS$/8EDUUHOVKLIWHUDQGPXOWLSOLHUWR SHUIRUPKLJKVSHHGGDWDRSHUDWLRQVLQDEDQNRIUHJLVWHUVDOOZLWKELWUHJLVWHUZLGWKV 7KUHHW\SHVRIORDGDQGVWRUHLQVWUXFWLRQVZKLFKFRQWUROGDWDWUDQVIHUEHWZHHQPHPRU\ORFDWLRQVDQGWKH UHJLVWHUV2QHW\SHLVRSWLPL]HGIRUIOH[LEOHDGGUHVVLQJDQRWKHUIRUUDSLGFRQWH[WVZLWFKLQJDQGWKHWKLUGIRU VZDSSLQJGDWD 7KUHHW\SHVRIFRSURFHVVRULQVWUXFWLRQVZKLFKDUHGHGLFDWHGWRFRQWUROOLQJH[WHUQDOFRSURFHVVRUV7KHVH LQVWUXFWLRQVH[WHQGWKHRIIFKLSIXQFWLRQDOLW\RIWKHLQVWUXFWLRQVHWLQDQRSHQDQGXQLIRUPZD\ 127( $OOELW$50LQVWUXFWLRQVFDQEHH[HFXWHGFRQGLWLRQDOO\ 7KHELW7+80%LQVWUXFWLRQVHWFRQWDLQVLQVWUXFWLRQIRUPDWVGUDZQIURPWKHVWDQGDUGELW$50LQVWUXFWLRQ VHW7KH7+80%LQVWUXFWLRQVFDQEHGLYLGHGLQWRIRXUIXQFWLRQDOJURXSV )RXUEUDQFKLQVWUXFWLRQV 7ZHOYHGDWDSURFHVVLQJLQVWUXFWLRQVZKLFKDUHDVXEVHWRIWKHVWDQGDUG$50GDWDSURFHVVLQJLQVWUXFWLRQV (LJKWORDGDQGVWRUHUHJLVWHULQVWUXFWLRQV )RXUORDGDQGVWRUHPXOWLSOHLQVWUXFWLRQV 127( (DFKELW7+80%LQVWUXFWLRQKDVDFRUUHVSRQGLQJELW$50LQVWUXFWLRQZLWKDQLGHQWLFDO SURFHVVLQJPRGHO 7KHELW$50LQVWUXFWLRQVHWDQGWKHELW7+80%LQVWUXFWLRQVHWDUHJRRGWDUJHWVIRUFRPSLOHUVRIPDQ\ GLIIHUHQWKLJKOHYHOODQJXDJHV:KHQDQDVVHPEO\FRGHLVUHTXLUHGIRUFULWLFDOFRGHVHJPHQWVWKH$50 SURJUDPPLQJWHFKQLTXHLVVWUDLJKWIRUZDUGXQOLNHWKDWRIVRPH5,6&SURFHVVRUVZKLFKGHSHQGRQVRSKLVWLFDWHG FRPSLOHUWHFKQRORJ\WRPDQDJHFRPSOLFDWHGLQVWUXFWLRQLQWHUGHSHQGHQFLHV 3LSHOLQLQJLVHPSOR\HGVRWKDWDOOSDUWVRIWKHSURFHVVRUDQGPHPRU\V\VWHPVFDQRSHUDWHFRQWLQXRXVO\7\SLFDOO\ ZKLOHRQHLQVWUXFWLRQLVEHLQJH[HFXWHGLWVVXFFHVVRULVEHLQJGHFRGHGDQGWKHWKLUGLQVWUXFWLRQLVEHLQJIHWFKHG IURPPHPRU\ 352'8&729(59,(: .6&5,6&0,&52&21752//(5 0(025<,17(5)$&( 7KH&38PHPRU\LQWHUIDFHKDVEHHQGHVLJQHGWRKHOSWKHKLJKHVWSHUIRUPDQFHSRWHQWLDOWREHUHDOL]HGZLWKRXW LQFXUULQJKLJKFRVWVLQWKHPHPRU\V\VWHP6SHHGFULWLFDOFRQWUROVLJQDOVDUHSLSHOLQHGVRWKDWV\VWHPFRQWURO IXQFWLRQVFDQEHLPSOHPHQWHGLQVWDQGDUGORZSRZHUORJLF7KHVHSLSHOLQHGFRQWUROVLJQDOVDOORZ\RXWRIXOO\H[SORLW WKHIDVWORFDODFFHVVPRGHVRIIHUHGE\LQGXVWU\VWDQGDUGG\QDPLF5$0V 23(5$7,1*67$7(6 )URPDSURJUDPPHUVSRLQWRIYLHZWKH$507'0,FRUHLVDOZD\VLQRQHRIWZRRSHUDWLQJVWDWHV7KHVHVWDWHV ZKLFKFDQEHVZLWFKHGE\VRIWZDUHRUE\H[FHSWLRQSURFHVVLQJDUH $50VWDWHZKHQH[HFXWLQJELWZRUGDOLJQHG$50LQVWUXFWLRQVDQG 7+80%VWDWHZKHQH[HFXWLQJELWKDOIZRUGDOLJQHG7+80%LQVWUXFWLRQV 23(5$7,1*02'(6 7KH$507'0,FRUHVXSSRUWVVHYHQRSHUDWLQJPRGHV 8VHUPRGHDQRUPDOSURJUDPH[HFXWLRQVWDWH ),4)DVW,QWHUUXSW5HTXHVWPRGHIRUVXSSRUWLQJDVSHFLILFGDWDWUDQVIHURUFKDQQHOSURFHVVLQJ ,54,QWHUUXSW5H4XHVWPRGHIRUJHQHUDOSXUSRVHLQWHUUXSWKDQGOLQJ 6XSHUYLVRUPRGHDSURWHFWHGPRGHIRUWKHRSHUDWLQJV\VWHP $ERUWPRGHHQWHUHGZKHQDGDWDRULQVWUXFWLRQSUHIHWFKLVDERUWHG 6\VWHPPRGHDSULYLOHJHGXVHUPRGHIRUWKHRSHUDWLQJV\VWHP 8QGHILQHGPRGHHQWHUHGZKHQDQXQGHILQHGLQVWUXFWLRQLVH[HFXWHG 2SHUDWLQJPRGHFKDQJHVFDQEHFRQWUROOHGE\VRIWZDUH7KH\FDQDOVREHFDXVHGE\H[WHUQDOLQWHUUXSWVRU H[FHSWLRQSURFHVVLQJ0RVWDSSOLFDWLRQSURJUDPVH[HFXWHLQ8VHUPRGH3ULYLOHJHGPRGHVWKDWLVDOOPRGHVRWKHU WKDQ8VHUPRGHDUHHQWHUHGWRVHUYLFHLQWHUUXSWVRUH[FHSWLRQVRUWRDFFHVVSURWHFWHGUHVRXUFHV .6&5,6&0,&52&21752//(5 352'8&729(59,(: 5(*,67(56 7KH.6&&38FRUHKDVDWRWDORIUHJLVWHUVJHQHUDOSXUSRVHELWUHJLVWHUVDQGVWDWXVUHJLVWHUV 1RWDOORIWKHVHUHJLVWHUVDUHDOZD\VDYDLODEOH:KHWKHUDUHJLVWHUVLVDYDLODEOHWRWKHSURJUDPPHUDWDQ\JLYHQWLPH GHSHQGVRQWKHFXUUHQWSURFHVVRURSHUDWLQJVWDWHDQGPRGH 127( :KHQWKH.6&LVRSHUDWLQJLQ$50VWDWHJHQHUDOUHJLVWHUVDQGRQHRUWZRVWDWXV UHJLVWHUVFDQEHDFFHVVHGDWDQ\WLPH,QSULYLOHJHGPRGHPRGHVSHFLILFEDQNHGUHJLVWHUVDUH VZLWFKHGLQ 7ZRUHJLVWHUVHWVRUEDQNVFDQDOVREHDFFHVVHGGHSHQGLQJRQWKHFRUHVFXUUHQWVWDWHWKH$50VWDWHUHJLVWHU VHWDQGWKH7+80%VWDWHUHJLVWHUVHW 7KH$50VWDWHUHJLVWHUVHWFRQWDLQVGLUHFWO\DFFHVVLEOHUHJLVWHUV55$OORIWKHVHUHJLVWHUVH[FHSWIRU 5DUHIRUJHQHUDOSXUSRVHXVHDQGFDQKROGHLWKHUGDWDRUDGGUHVVYDOXHV$QDGGLWLRQDOWKUHJLVWHUWKH &365&XUUHQW3URJUDP6WDWXV5HJLVWHULVXVHGWRVWRUHVWDWXVLQIRUPDWLRQ 7KH7+80%VWDWHUHJLVWHUVHWLVDVXEVHWRIWKH$50VWDWHVHW<RXFDQDFFHVVJHQHUDOUHJLVWHUV55DV ZHOODVWKHSURJUDPFRXQWHU3&DVWDFNSRLQWHUUHJLVWHU63DOLQNUHJLVWHU/5DQGWKH&365(DFK SULYLOHJHGPRGHKDVDFRUUHVSRQGLQJEDQNHGVWDFNSRLQWHUOLQNUHJLVWHUDQGVDYHGSURFHVVVWDWXVUHJLVWHU 6365 7KH7+80%VWDWHUHJLVWHUVDUHUHODWHGWRWKH$50VWDWHUHJLVWHUVDVIROORZV 7+80%VWDWH55UHJLVWHUVDQG$50VWDWH55UHJLVWHUVDUHLGHQWLFDO 7+80%VWDWH&365DQG6365VDQG$50VWDWH&365DQG6365VDUHLGHQWLFDO 7+80%VWDWH63/5DQG3&DUHPDSSHGGLUHFWO\WR$50VWDWHUHJLVWHUV55DQG5UHVSHFWLYHO\ ,Q7+80%VWDWHUHJLVWHUV55DUHQRWSDUWRIWKHVWDQGDUGUHJLVWHUVHW+RZHYHU\RXFDQDFFHVVWKHPIRU DVVHPEO\ODQJXDJHSURJUDPPLQJDQGXVHWKHPIRUIDVWWHPSRUDU\VWRUDJHLIQHFHVVDU\ 352'8&729(59,(: .6&5,6&0,&52&21752//(5 (;&(37,216 $QH[FHSWLRQDULVHVZKHQWKHQRUPDOIORZRISURJUDPH[HFXWLRQLVLQWHUUXSWHGHJZKHQSURFHVVLQJLVGLYHUWHGWR KDQGOHDQLQWHUUXSWIURPDSHULSKHUDO7KHSURFHVVRUVWDWHMXVWSULRUWRKDQGOLQJWKHH[FHSWLRQPXVWEHSUHVHUYHGVR WKDWWKHSURJUDPIORZFDQEHUHVXPHGZKHQWKHH[FHSWLRQURXWLQHLVFRPSOHWHG0XOWLSOHH[FHSWLRQVPD\DULVH VLPXOWDQHRXVO\ 7RSURFHVVH[FHSWLRQVWKH.6&XVHVWKHEDQNHGFRUHUHJLVWHUVWRVDYHWKHFXUUHQWVWDWH7KHROG3& YDOXHDQGWKH&365FRQWHQWVDUHFRSLHGLQWRWKHDSSURSULDWH5/5DQG6365UHJLVWHUV7KH3&DQGPRGHELWV LQWKH&365DUHDGMXVWHGWRWKHYDOXHFRUUHVSRQGLQJWRWKHW\SHRIH[FHSWLRQEHLQJSURFHVVHG 7KH.6&FRUHVXSSRUWVVHYHQW\SHVRIH[FHSWLRQV(DFKH[FHSWLRQKDVDIL[HGSULRULW\DQGD FRUUHVSRQGLQJSULYLOHJHGSURFHVVRUPRGHDVVKRZQLQ7DEOH 7DEOH.6&&38([FHSWLRQV ([FHSWLRQ 5HVHW 'DWDDERUW ),4 ,54 3UHIHWFKDERUW 8QGHILQHGLQVWUXFWLRQ 6:, 0RGHRQ(QWU\ 6XSHUYLVRUPRGH $ERUWPRGH ),4PRGH ,54PRGH $ERUWPRGH 8QGHILQHGPRGH 6XSHUYLVRUPRGH 3ULRULW\ +LJKHVW /RZHVW .6&5,6&0,&52&21752//(5 352'8&729(59,(: 63(&,$/5(*,67(56 7DEOH.6&6SHFLDO5HJLVWHUV *URXS 6\VWHP 0DQDJHU 5HJLVWHUV 6<6&)* &/.&21 (;7$&21 (;7$&21 (;7'%:7+ 520&21 520&21 520&21 520&21 520&21 520&21 '5$0&21 '5$0&21 '5$0&21 '5$0&21 5()(;7&21 (WKHUQHW %'0$ %'0$7;&21 %'0$5;&21 %'0$7;375 %'0$5;375 %'0$5;/6= %'0$67$7 &$0 %'0$7;%8) %'0$5;%8) 2IIVHW [ [ [ [& [ [ [ [& [ [ [ [& [ [ [ [& [ [ [ [& [ [ [ [& [ [)& [ [)& 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: : 5: 5: 'HVFULSWLRQ 6\VWHPFRQILJXUDWLRQUHJLVWHU &ORFNFRQWUROUHJLVWHU ([WHUQDO,2WLPLQJUHJLVWHU ([WHUQDO,2WLPLQJUHJLVWHU 'DWDEXVZLGWKIRUHDFKPHPRU\EDQN 52065$0)ODVKEDQNFRQWUROUHJLVWHU 52065$0)ODVKEDQNFRQWUROUHJLVWHU 52065$0)ODVKEDQNFRQWUROUHJLVWHU 52065$0)ODVKEDQNFRQWUROUHJLVWHU 52065$0)ODVKEDQNFRQWUROUHJLVWHU 52065$0)ODVKEDQNFRQWUROUHJLVWHU '5$0EDQNFRQWUROUHJLVWHU '5$0EDQNFRQWUROUHJLVWHU '5$0EDQNFRQWUROUHJLVWHU '5$0EDQNFRQWUROUHJLVWHU 5HIUHVKDQGH[WHUQDO,2FRQWUROUHJLVWHU %XIIHUHG'0$UHFHLYHFRQWUROUHJLVWHU %XIIHUHG'0$WUDQVPLWFRQWUROUHJLVWHU 7UDQVPLWWUDPHGHVFULSWRUVWDUWDGGUHVV 5HFHLYHIUDPHGHVFULSWRUVWDUWDGGUHVV 5HFHLYHIUDPHPD[LPXPVL]H %XIIHUHG'0$VWDWXV &$0FRQWHQWZRUGV %'0$7[EXIIHUZRUGVIRUWHVWPRGH DGGUHVVLQJ %'0$5[EXIIHUZRUGVIRUWHVWPRGH DGGUHVVLQJ 5HVHW9DOXH [)))) [ [ [ [ [ [ [ [ [ [ [ [ [ [ [)' [ [ [)))))))) [)))))))) 8QGHILQHG [ 8QGHILQHG 8QGHILQHG 8QGHILQHG 352'8&729(59,(: .6&5,6&0,&52&21752//(5 7DEOH.6&6SHFLDO5HJLVWHUV *URXS (WKHUQHW 0$& 5HJLVWHUV 0$&21 &$0&21 0$&7;&21 0$&7;67$7 0$&5;&21 0$&5;67$7 67$'$7$ 67$&21 &$0(1 (0,66&17 (3=&17 (503=&17 (7;67$7 +'/& &KDQQHO$ +02'( +&21 +67$7 +,17(1 +7;),)2& +7;),)27 +5;),)2 +%5*7& +350% +6$5 +6$5 +6$5 +6$5 +0$6. +'0$7;375 +'0$5;375 +0)/5 +5%65 2IIVHW [$ [$ [$ [$& [$ [$ [$ [$& [$ [$& [$ [$ [ [ [ [ [F [ [ [ [F [ [ [ [F [ [ [ [F [ [ 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5 5 5 5: 5: 5: 5: : : 5 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 'HVFULSWLRQ (WKHUQHW0$&FRQWUROUHJLVWHU &$0FRQWUROUHJLVWHU 0$&WUDQVPLWFRQWUROUHJLVWHU 0$&WUDQVPLWVWDWXVUHJLVWHU 0$&UHFHLYHFRQWUROUHJLVWHU 0$&UHFHLYHVWDWXVUHJLVWHU 6WDWLRQPDQDJHPHQWGDWD 6WDWLRQPDQDJHPHQWFRQWURODQGDGGUHVV &$0HQDEOHUHJLVWHU 0LVVHGHUURUFRXQWUHJLVWHU 3DXVHFRXQWUHJLVWHU 5HPRWHSDXVHFRXQWUHJLVWHU 7UDQVPLWFRQWUROIUDPHVWDWXV +'/&PRGHUHJLVWHU +'/&FRQWUROUHJLVWHU +'/&VWDWXVUHJLVWHU +'/&LQWHUUXSWHQDEOHUHJLVWHU 7[),)2IUDPHFRQWLQXHUHJLVWHU 7[),)2IUDPHWHUPLQDWHUHJLVWHU +'/&5[),)2HQWU\UHJLVWHU +'/&%DXGUDWHJHQHUDWHWLPHFRQVWDQW +'/&3UHDPEOH&RQVWDQW +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&PDVNUHJLVWHU '0$7[EXIIHUGHVFULSWRUSRLQWHU '0$5[EXIIHUGHVFULSWRUSRLQWHU 0D[LPXPIUDPHOHQJWKUHJLVWHU '0$UHFHLYHEXIIHUVL]HUHJLVWHU 5HVHW9DOXH [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [)))))))) [)))))))) [;;;; [;;;; .6&5,6&0,&52&21752//(5 352'8&729(59,(: 7DEOH.6&6SHFLDO5HJLVWHUV *URXS +'/& &KDQQHO% 5HJLVWHUV +02'( +&21 +67$7 +,17(1 +7;),)2& +7;),)27 +5;),)2 +%5*7& +350% +6$5 +6$5 +6$5 +6$5 +0$6. +'0$7;375 +'0$5;375 +0)/5 +5%65 ,23RUWV ,2302' ,23&21 ,23'$7$ ,QWHUUXSW &RQWUROOHU ,1702' ,1731' ,1706. ,1735, ,1735, ,1735, ,1735, ,1735, ,1735, ,172))6(7 ,1726(7B),4 ,1726(7B,54 2IIVHW [ [ [ [& [ [ [ [& [ [ [ [F [ [ [ [F [ [ [ [ [ [ [ [ [& [ [ [ [& [ [ [ [ 5: 5: 5: 5: 5: : : 5 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5 5 5 'HVFULSWLRQ +'/&PRGHUHJLVWHU +'/&FRQWUROUHJLVWHU +'/&VWDWXVUHJLVWHU +'/&LQWHUUXSWHQDEOHUHJLVWHU 7[),)2IUDPHFRQWLQXHUHJLVWHU 7[),)2IUDPHWHUPLQDWHUHJLVWHU +'/&5[),)2HQWU\UHJLVWHU +'/&%DXGUDWHJHQHUDWHWLPHFRQVWDQW +'/&3UHDPEOH&RQVWDQW +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&PDVNUHJLVWHU '0$7[EXIIHUGHVFULSWRUSRLQWHU '0$5[EXIIHUGHVFULSWRUSRLQWHU 0D[LPXPIUDPHOHQJWKUHJLVWHU '0$UHFHLYHEXIIHUVL]HUHJLVWHU ,2SRUWPRGHUHJLVWHU ,2SRUWFRQWUROUHJLVWHU ,QSXWSRUWGDWDUHJLVWHU ,QWHUUXSWPRGHUHJLVWHU ,QWHUUXSWSHQGLQJUHJLVWHU ,QWHUUXSWPDVNUHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWRIIVHWDGGUHVVUHJLVWHU ),4LQWHUUXSWRIIVHWUHJLVWHU ,54LQWHUUXSWRIIVHWUHJLVWHU 5HVHW9DOXH [ [ [ [ [ [ [ [ [ [ [ [ [)))))))) [)))))))) [;;;; [;;;; [ [ 8QGHILQHG [ [ [))))) [ [ [%$ [)('& [ [ [ [ [ 352'8&729(59,(: .6&5,6&0,&52&21752//(5 7DEOH.6&6SHFLDO5HJLVWHUV *URXS ,&%XV 5HJLVWHUV ,,&&21 ,,&%8) ,,&36 ,,&&2817 *'0$ *'0$&21 *'0$&21 *'0$65& *'0$'67 *'0$65& *'0$'67 *'0$&17 *'0$&17 8$57 8/&21 8/&21 8&21 8&21 867$7 867$7 87;%8) 87;%8) 85;%8) 85;%8) 8%5',9 8%5',9 7LPHUV 702' 7'$7$ 7'$7$ 7&17 7&17 2IIVHW [) [) [) [)& [% [& [% [% [& [& [%& [&& [' [( [' [( [' [( ['& [(& [' [( [' [( [ [ [ [& [ 5: 5: 5: 5: 5 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5 5 : : 5 5 5: 5: 5: 5: 5: 5: 5: 'HVFULSWLRQ ,&EXVFRQWUROVWDWXVUHJLVWHU ,&EXVVKLIWEXIIHUUHJLVWHU ,&EXVSUHVFDOHUUHJLVWHU ,&EXVSUHVFDOHUFRXQWHUUHJLVWHU *'0$FKDQQHOFRQWUROUHJLVWHU *'0$FKDQQHOFRQWUROUHJLVWHU *'0$VRXUFHDGGUHVVUHJLVWHU *'0$GHVWLQDWLRQDGGUHVVUHJLVWHU *'0$VRXUFHDGGUHVVUHJLVWHU *'0$GHVWLQDWLRQDGGUHVVUHJLVWHU *'0$FKDQQHOWUDQVIHUFRXQWUHJLVWHU *'0$FKDQQHOWUDQVIHUFRXQWUHJLVWHU 8$57FKDQQHOOLQHFRQWUROUHJLVWHU 8$57FKDQQHOOLQHFRQWUROUHJLVWHU 8$57FKDQQHOFRQWUROUHJLVWHU 8$57FKDQQHOFRQWUROUHJLVWHU 8$57FKDQQHOVWDWXVUHJLVWHU 8$57FKDQQHOVWDWXVUHJLVWHU 8$57FKDQQHOWUDQVPLWKROGLQJUHJLVWHU 8$57FKDQQHOWUDQVPLWKROGLQJUHJLVWHU 8$57FKDQQHOUHFHLYHEXIIHUUHJLVWHU 8$57FKDQQHOUHFHLYHEXIIHUUHJLVWHU %DXGUDWHGLYLVRUUHJLVWHU %DXGUDWHGLYLVRUUHJLVWHU 7LPHUPRGHUHJLVWHU 7LPHUGDWDUHJLVWHU 7LPHUGDWDUHJLVWHU 7LPHUFRXQWUHJLVWHU 7LPHUFRXQWUHJLVWHU 5HVHW9DOXH [ 8QGHILQHG [ [ [ [ 8QGHILQHG 8QGHILQHG 8QGHILQHG 8QGHILQHG 8QGHILQHG 8QGHILQHG [ [ [ [ [& [& 8QGHILQHG 8QGHILQHG 8QGHILQHG 8QGHILQHG [ [ [ [ [ [)))))))) [)))))))) .6&5,6&0,&52&21752//(5 352'8&729(59,(: 127(6 352'8&729(59,(: .6&5,6&0,&52&21752//(5 .6&5,6&0,&52&21752//(5 352*5$00(5602'(/ 3URJUDPPHUV0RGHO 29(59,(: .6&ZDVGHYHORSHGXVLQJWKHDGYDQFHG$507'0,FRUHGHVLJQHGE\$GYDQFHG5,6&0DFKLQHV/WG 352&(662523(5$7,1*67$7(6 )URPWKHSURJUDPPHUVSRLQWRIYLHZWKH$507'0,FDQEHLQRQHRIWZRVWDWHV $50VWDWHZKLFKH[HFXWHVELWZRUGDOLJQHG$50LQVWUXFWLRQV 7+80%VWDWHZKLFKRSHUDWHVZLWKELWKDOIZRUGDOLJQHG7+80%LQVWUXFWLRQV,QWKLVVWDWHWKH3&XVHVELW WRVHOHFWEHWZHHQDOWHUQDWHKDOIZRUGV 127( 7UDQVLWLRQEHWZHHQWKHVHWZRVWDWHVGRHVQRWDIIHFWWKHSURFHVVRUPRGHRUWKHFRQWHQWVRIWKHUHJLVWHUV 6:,7&+,1*67$7( (QWHULQJ7+80%6WDWH (QWU\LQWR7+80%VWDWHFDQEHDFKLHYHGE\H[HFXWLQJDLQVWUXFWLRQZLWKWKHVWDWHELWELWVHWLQWKHRSHUDQG UHJLVWHU 7UDQVLWLRQWR7+80%VWDWHZLOODOVRRFFXUDXWRPDWLFDOO\RQUHWXUQIURPDQH[FHSWLRQ,54),481'()$%257 6:,HWFLIWKHH[FHSWLRQZDVHQWHUHGZLWKWKHSURFHVVRULQ7+80%VWDWH (QWHULQJ$506WDWH (QWU\LQWR$50VWDWHKDSSHQV 2QH[HFXWLRQRIWKHLQVWUXFWLRQZLWKWKHVWDWHELWFOHDULQWKHRSHUDQGUHJLVWHU 2QWKHSURFHVVRUWDNLQJDQH[FHSWLRQ,54),45(6(781'()$%2576:,HWF,QWKLVFDVHWKH3&LV SODFHGLQWKHH[FHSWLRQPRGHVOLQNUHJLVWHUDQGH[HFXWLRQFRPPHQFHVDWWKHH[FHSWLRQVYHFWRUDGGUHVV 0(025<)250$76 $507'0,YLHZVPHPRU\DVDOLQHDUFROOHFWLRQRIE\WHVQXPEHUHGXSZDUGVIURP]HUR%\WHVWRKROGWKHILUVW VWRUHGZRUGE\WHVWRWKHVHFRQGDQGVRRQ$507'0,FDQWUHDWZRUGVLQPHPRU\DVEHLQJVWRUHGHLWKHULQ %LJ(QGLDQRU/LWWOH(QGLDQIRUPDW 352*5$00(5602'(/ .6&5,6&0,&52&21752/(5 %,*(1',$1)250$7 ,Q%LJ(QGLDQIRUPDWWKHPRVWVLJQLILFDQWE\WHRIDZRUGLVVWRUHGDWWKHORZHVWQXPEHUHGE\WHDQGWKHOHDVW VLJQLILFDQWE\WHDWWKHKLJKHVWQXPEHUHGE\WH%\WHRIWKHPHPRU\V\VWHPLVWKHUHIRUHFRQQHFWHGWRGDWDOLQHV WKURXJK +LJKHU$GGUHVV /RZHU$GGUHVV :RUG$GGUHVV 0RVWVLJQLILFDQWE\WHLVDWORZHVWDGGUHVV :RUGLVDGGUHVVHGE\E\WHDGGUHVVRIPRVWVLJQLILFDQWE\WH )LJXUH%LJ(QGLDQ$GGUHVVHVRI%\WHVZLWKLQ:RUGV 127( 7KHGDWDORFDWLRQVLQWKHH[WHUQDOPHPRU\DUHGLIIHUHQWZLWK)LJXUHLQWKH.6&3OHDVHUHIHUWR WKHFKDSWHU6\VWHP0DQDJHU /,77/((1',$1)250$7 ,Q/LWWOH(QGLDQIRUPDWWKHORZHVWQXPEHUHGE\WHLQDZRUGLVFRQVLGHUHGWKHZRUGVOHDVWVLJQLILFDQWE\WHDQGWKH KLJKHVWQXPEHUHGE\WHWKHPRVWVLJQLILFDQW%\WHRIWKHPHPRU\V\VWHPLVWKHUHIRUHFRQQHFWHGWRGDWDOLQHV WKURXJK +LJKHU$GGUHVV /RZHU$GGUHVV :RUG$GGUHVV /HDVWVLJQLILFDQWE\WHLVDWORZHVWDGGUHVV :RUGLVDGGUHVVHGE\E\WHDGGUHVVRIOHDVWVLJQLILFDQWE\WH )LJXUH/LWWOH(QGLDQ$GGUHVVHVRI%\WHVZLWKLQ:RUGV ,16758&7,21/(1*7+ ,QVWUXFWLRQVDUHHLWKHUELWVORQJLQ$50VWDWHRUELWVORQJLQ7+80%VWDWH 'DWD7\SHV $507'0,VXSSRUWVE\WHELWKDOIZRUGELWDQGZRUGELWGDWDW\SHV:RUGVPXVWEHDOLJQHGWRIRXU E\WHERXQGDULHVDQGKDOIZRUGVWRWZRE\WHERXQGDULHV .6&5,6&0,&52&21752//(5 352*5$00(5602'(/ 23(5$7,1*02'(6 $507'0,VXSSRUWVVHYHQPRGHVRIRSHUDWLRQ 8VHUXVU ),4ILT ,54LUT 6XSHUYLVRUVYF 6\VWHPV\V 7KHQRUPDO$50SURJUDPH[HFXWLRQVWDWH 'HVLJQHGWRVXSSRUWDGDWDWUDQVIHURUFKDQQHOSURFHVV 8VHGIRUJHQHUDOSXUSRVHLQWHUUXSWKDQGOLQJ 3URWHFWHGPRGHIRUWKHRSHUDWLQJV\VWHP $SULYLOHJHGXVHUPRGHIRUWKHRSHUDWLQJV\VWHP $ERUWPRGHDEW (QWHUHGDIWHUDGDWDRULQVWUXFWLRQSUHIHWFKDERUW 8QGHILQHGXQG (QWHUHGZKHQDQXQGHILQHGLQVWUXFWLRQLVH[HFXWHG 0RGHFKDQJHVPD\EHPDGHXQGHUVRIWZDUHFRQWURORUPD\EHEURXJKWDERXWE\H[WHUQDOLQWHUUXSWVRUH[FHSWLRQ SURFHVVLQJ0RVWDSSOLFDWLRQSURJUDPVZLOOH[HFXWHLQ8VHUPRGH7KHQRQXVHUPRGHVNQRZQDVSULYLOHJHG PRGHVDUHHQWHUHGLQRUGHUWRVHUYLFHLQWHUUXSWVRUH[FHSWLRQVRUWRDFFHVVSURWHFWHGUHVRXUFHV 5(*,67(56 $507'0,KDVDWRWDORIUHJLVWHUVJHQHUDOSXUSRVHELWUHJLVWHUVDQGVL[VWDWXVUHJLVWHUVEXWWKHVH FDQQRWDOOEHVHHQDWRQFH7KHSURFHVVRUVWDWHDQGRSHUDWLQJPRGHGLFWDWHZKLFKUHJLVWHUVDUHDYDLODEOHWRWKH SURJUDPPHU 7KH$506WDWH5HJLVWHU6HW ,Q$50VWDWHJHQHUDOUHJLVWHUVDQGRQHRUWZRVWDWXVUHJLVWHUVDUHYLVLEOHDWDQ\RQHWLPH,QSULYLOHJHGQRQ 8VHUPRGHVPRGHVSHFLILFEDQNHGUHJLVWHUVDUHVZLWFKHGLQ)LJXUHVKRZVZKLFKUHJLVWHUVDUHDYDLODEOHLQ HDFKPRGHWKHEDQNHGUHJLVWHUVDUHPDUNHGZLWKDVKDGHGWULDQJOH 7KH$50VWDWHUHJLVWHUVHWFRQWDLQVGLUHFWO\DFFHVVLEOHUHJLVWHUV5WR5$OORIWKHVHH[FHSW5DUH JHQHUDOSXUSRVHDQGPD\EHXVHGWRKROGHLWKHUGDWDRUDGGUHVVYDOXHV,QDGGLWLRQWRWKHVHWKHUHLVD VHYHQWHHQWKUHJLVWHUXVHGWRVWRUHVWDWXVLQIRUPDWLRQ 5HJLVWHU LVXVHGDVWKHVXEURXWLQHOLQNUHJLVWHU7KLVUHFHLYHVDFRS\RI5ZKHQD%UDQFKDQG /LQN%/LQVWUXFWLRQLVH[HFXWHG$WDOORWKHUWLPHVLWPD\EHWUHDWHGDVDJHQHUDO SXUSRVHUHJLVWHU7KHFRUUHVSRQGLQJEDQNHGUHJLVWHUV5BVYF5BLUT5BILT 5BDEWDQG5BXQGDUHVLPLODUO\XVHGWRKROGWKHUHWXUQYDOXHVRI5ZKHQ LQWHUUXSWVDQGH[FHSWLRQVDULVHRUZKHQ%UDQFKDQG/LQNLQVWUXFWLRQVDUHH[HFXWHG ZLWKLQLQWHUUXSWRUH[FHSWLRQURXWLQHV KROGVWKH3URJUDP&RXQWHU3&,Q$50VWDWHELWV>@RI5DUH]HURDQGELWV>@ FRQWDLQWKH3&,Q7+80%VWDWHELW>@LV]HURDQGELWV>@FRQWDLQWKH3& LVWKH&365&XUUHQW3URJUDP6WDWXV5HJLVWHU7KLVFRQWDLQVFRQGLWLRQFRGHIODJVDQG WKHFXUUHQWPRGHELWV 5HJLVWHU 5HJLVWHU ),4PRGHKDVVHYHQEDQNHGUHJLVWHUVPDSSHGWR55BILT5BILT,Q$50VWDWHPDQ\),4KDQGOHUVGRQRW QHHGWRVDYHDQ\UHJLVWHUV8VHU,546XSHUYLVRU$ERUWDQG8QGHILQHGHDFKKDYHWZREDQNHGUHJLVWHUVPDSSHG WR5DQG5DOORZLQJHDFKRIWKHVHPRGHVWRKDYHDSULYDWHVWDFNSRLQWHUDQGOLQNUHJLVWHUV 352*5$00(5602'(/ .6&5,6&0,&52&21752/(5 $506WDWH*HQHUDO5HJLVWHUVDQG3URJUDP&RXQWHU 6\VWHP8VHU 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 53& 5 5 5 5 5 5 5 5 5BILT 5BILT 5BILT 5BILT 5BILT 5BILT 5BILT 53& ),4 6XSHUYLVRU 5 5 5 5 5 5 5 5 5 5 5 5 5 5BVYF 5BVYF 53& $ERUW 5 5 5 5 5 5 5 5 5 5 5 5 5 5BDEW 5BDEW 53& 5 5 5 5 5 5 5 5 5 5 ,54 8QGHILQHG 5 5 5 5 5 5 5 5 5 5 5 5 5 5BXQG 5BXQG 53& 5 5 5 5BLUT 5BLUT 53& $506WDWH3URJUDP6WDWXV5HJLVWHUV &365 &365 6365BILT &365 6365BVYF &365 6365BDEW &365 6365BLUT &365 6365BXQG EDQNHGUHJLVWHU )LJXUH5HJLVWHU2UJDQL]DWLRQLQ$506WDWH .6&5,6&0,&52&21752//(5 352*5$00(5602'(/ 7KH7+80%6WDWH5HJLVWHU6HW 7KH7+80%VWDWHUHJLVWHUVHWLVDVXEVHWRIWKH$50VWDWHVHW7KHSURJUDPPHUKDVGLUHFWDFFHVVWRHLJKWJHQHUDO UHJLVWHUV55DVZHOODVWKH3URJUDP&RXQWHU3&DVWDFNSRLQWHUUHJLVWHU63DOLQNUHJLVWHU/5DQGWKH &3657KHUHDUHEDQNHG6WDFN3RLQWHUV/LQN5HJLVWHUVDQG6DYHG3URFHVV6WDWXV5HJLVWHUV6365VIRUHDFK SULYLOHJHGPRGH7KLVLVVKRZQLQ)LJXUH 7+80%6WDWH*HQHUDO5HJLVWHUVDQG3URJUDP&RXQWHU 6\VWHP8VHU 5 5 5 5 5 5 5 5 63 /5 3& 5 5 5 5 5 5 5 5 63BILT /5BILT 3& ),4 6XSHUYLVRU 5 5 5 5 5 5 5 5 63BVYF /5BVYF 3& $ERUW 5 5 5 5 5 5 5 5 63BDEW /5BDEW 3& 5 5 5 5 5 5 5 5 ,54 8QGHILQHG 5 5 5 5 5 5 5 5 63BXQG /5BXQG 3& 63BLUT /5BLUT 3& 7+80%6WDWH3URJUDP6WDWXV5HJLVWHUV &365 &365 6365BILT &365 6365BVYF &365 6365BDEW &365 6365BLUT &365 6365BXQG EDQNHGUHJLVWHU )LJXUH5HJLVWHU2UJDQL]DWLRQLQ7+80%6WDWH 352*5$00(5602'(/ .6&5,6&0,&52&21752/(5 7KHUHODWLRQVKLSEHWZHHQ$50DQG7+80%VWDWHUHJLVWHUV 7KH7+80%VWDWHUHJLVWHUVUHODWHWRWKH$50VWDWHUHJLVWHUVLQWKHIROORZLQJZD\ 7+80%VWDWH55DQG$50VWDWH55DUHLGHQWLFDO 7+80%VWDWH&365DQG6365VDQG$50VWDWH&365DQG6365VDUHLGHQWLFDO 7+80%VWDWH63PDSVRQWR$50VWDWH5 7+80%VWDWH/5PDSVRQWR$50VWDWH5 7KH7+80%VWDWH3URJUDP&RXQWHUPDSVRQWRWKH$50VWDWH3URJUDP&RXQWHU5 7KLVUHODWLRQVKLSLVVKRZQLQ)LJXUH 7+80%VWDWH 5 5 5 5 5 5 5 5 $50VWDWH 5 5 5 5 5 5 5 5 5 5 5 6WDFN3RLQWHU63 /LQN5HJLVWHU/5 3URJUDP&RXQWHU3& &365 6365 6WDFN3RLQWHU5 /LQN5HJLVWHU5 3URJUDP&RXQWHU5 &365 6365 +LUHJLVWHUV 5 /RUHJLVWHUV 5 )LJXUH0DSSLQJRI7+80%6WDWH5HJLVWHUVRQWR$506WDWH5HJLVWHUV .6&5,6&0,&52&21752//(5 352*5$00(5602'(/ $FFHVVLQJ+L5HJLVWHUVLQ7+80%6WDWH ,Q7+80%VWDWHUHJLVWHUV55WKH+LUHJLVWHUVDUHQRWSDUWRIWKHVWDQGDUGUHJLVWHUVHW+RZHYHUWKHDVVHPEO\ ODQJXDJHSURJUDPPHUKDVOLPLWHGDFFHVVWRWKHPDQGFDQXVHWKHPIRUIDVWWHPSRUDU\VWRUDJH $YDOXHPD\EHWUDQVIHUUHGIURPDUHJLVWHULQWKHUDQJH55D/RUHJLVWHUWRD+LUHJLVWHUDQGIURPD+LUHJLVWHU WRD/RUHJLVWHUXVLQJVSHFLDOYDULDQWVRIWKHLQVWUXFWLRQ+LUHJLVWHUYDOXHVFDQDOVREHFRPSDUHGDJDLQVWRU DGGHGWR/RUHJLVWHUYDOXHVZLWKWKH&03DQG$''LQVWUXFWLRQV)RUPRUHLQIRUPDWLRQUHIHUWR)LJXUH 7+(352*5$067$7865(*,67(56 7KH$507'0,FRQWDLQVD&XUUHQW3URJUDP6WDWXV5HJLVWHU&365SOXVILYH6DYHG3URJUDP6WDWXV5HJLVWHUV 6365VIRUXVHE\H[FHSWLRQKDQGOHUV7KHVHUHJLVWHUVIXQFWLRQVDUH +ROGLQIRUPDWLRQDERXWWKHPRVWUHFHQWO\SHUIRUPHG$/8RSHUDWLRQ &RQWUROWKHHQDEOLQJDQGGLVDEOLQJRILQWHUUXSWV 6HWWKHSURFHVVRURSHUDWLQJPRGH 7KHDUUDQJHPHQWRIELWVLVVKRZQLQ)LJXUH FRQGLWLRQFRGHIODJV UHVHUYHG FRQWUROELWV 1 = & 9 , ) 7 0 0 0 0 0 0RGHELWV 6WDWHELW ),4GLVDEOH ,54GLVDEOH 2YHUIORZ &DUU\%RUURZ ([WHQG =HUR 1HJDWLYH/HVV7KDQ )LJXUH3URJUDP6WDWXV5HJLVWHU)RUPDW 352*5$00(5602'(/ .6&5,6&0,&52&21752/(5 7KH&RQGLWLRQ&RGH)ODJV 7KH1=&DQG9ELWVDUHWKHFRQGLWLRQFRGHIODJV7KHVHPD\EHFKDQJHGDVDUHVXOWRIDULWKPHWLFDQGORJLFDO RSHUDWLRQVDQGPD\EHWHVWHGWRGHWHUPLQHZKHWKHUDQLQVWUXFWLRQVKRXOGEHH[HFXWHG ,Q$50VWDWHDOOLQVWUXFWLRQVPD\EHH[HFXWHGFRQGLWLRQDOO\VHH7DEOHIRUGHWDLOV ,Q7+80%VWDWHRQO\WKH%UDQFKLQVWUXFWLRQLVFDSDEOHRIFRQGLWLRQDOH[HFXWLRQVHH)LJXUHIRUGHWDLOV 7KH&RQWURO%LWV 7KHERWWRPELWVRID365LQFRUSRUDWLQJ,)7DQG0>@DUHNQRZQFROOHFWLYHO\DVWKHFRQWUROELWV7KHVHZLOO FKDQJHZKHQDQH[FHSWLRQDULVHV,IWKHSURFHVVRULVRSHUDWLQJLQDSULYLOHJHGPRGHWKH\FDQDOVREHPDQLSXODWHG E\VRIWZDUH 7KH7ELW 7KLVUHIOHFWVWKHRSHUDWLQJVWDWH:KHQWKLVELWLVVHWWKHSURFHVVRULVH[HFXWLQJLQ 7+80%VWDWHRWKHUZLVHLWLVH[HFXWLQJLQ$50VWDWH7KLVLVUHIOHFWHGRQWKH7%,7 H[WHUQDOVLJQDO 1RWHWKDWWKHVRIWZDUHPXVWQHYHUFKDQJHWKHVWDWHRIWKH7%,7LQWKH&365,IWKLV KDSSHQVWKHSURFHVVRUZLOOHQWHUDQXQSUHGLFWDEOHVWDWH ,QWHUUXSWGLVDEOHELWV 7KHPRGHELWV 7KH,DQG)ELWVDUHWKHLQWHUUXSWGLVDEOHELWV:KHQVHWWKHVHGLVDEOHWKH,54DQG),4 LQWHUUXSWVUHVSHFWLYHO\ 7KH0000DQG0ELWV0>@DUHWKHPRGHELWV7KHVHGHWHUPLQHWKH SURFHVVRUVRSHUDWLQJPRGHDVVKRZQLQ7DEOH1RWDOOFRPELQDWLRQVRIWKHPRGH ELWVGHILQHDYDOLGSURFHVVRUPRGH2QO\WKRVHH[SOLFLWO\GHVFULEHGVKDOOEHXVHG7KH XVHUVKRXOGEHDZDUHWKDWLIDQ\LOOHJDOYDOXHLVSURJUDPPHGLQWRWKHPRGHELWV0>@ WKHQWKHSURFHVVRUZLOOHQWHUDQXQUHFRYHUDEOHVWDWH,IWKLVRFFXUVUHVHWVKRXOGEH DSSOLHG .6&5,6&0,&52&21752//(5 352*5$00(5602'(/ 7DEOH3650RGH%LW9DOXHV 0>@ 0RGH 8VHU 9LVLEOH7+80%VWDWH UHJLVWHUV 55 /563 3&&365 55 /5BILT63BILT 3&&3656365BILT 55 /5BLUT63BLUT 3&&3656365BLUT 9LVLEOH$50VWDWH UHJLVWHUV 55 3&&365 55 5BILT5BILT 3&&3656365BILT 55 5BLUT5BLUT 3&&3656365BLUT ),4 ,54 6XSHUYLVRU 55 55 /5BVYF63BVYF 5BVYF5BVYF 3&&3656365BVYF 3&&3656365BVYF 55 55 /5BDEW63BDEW 5BDEW5BDEW 3&&3656365BDEW 3&&3656365BDEW 55 /5BXQG63BXQG 3&&365 6365BXQG 55 /563 3&&365 55 5BXQG5BXQG 3&&365 55 3&&365 $ERUW 8QGHILQHG 6\VWHP 5HVHUYHGELWV 7KHUHPDLQLQJELWVLQWKH365VDUHUHVHUYHG:KHQFKDQJLQJD365VIODJRUFRQWURO ELWV\RXPXVWHQVXUHWKDWWKHVHXQXVHGELWVDUHQRWDOWHUHG$OVR\RXUSURJUDPVKRXOG QRWUHO\RQWKHPFRQWDLQLQJVSHFLILFYDOXHVVLQFHLQIXWXUHSURFHVVRUVWKH\PD\UHDGDV RQHRU]HUR 352*5$00(5602'(/ .6&5,6&0,&52&21752/(5 (;&(37,216 ([FHSWLRQVDULVHZKHQHYHUWKHQRUPDOIORZRIDSURJUDPKDVWREHKDOWHGWHPSRUDULO\IRUH[DPSOHWRVHUYLFHDQ LQWHUUXSWIURPDSHULSKHUDO%HIRUHDQH[FHSWLRQFDQEHKDQGOHGWKHFXUUHQWSURFHVVRUVWDWHPXVWEHSUHVHUYHGVR WKDWWKHRULJLQDOSURJUDPFDQUHVXPHZKHQWKHKDQGOHUURXWLQHKDVILQLVKHG ,WLVSRVVLEOHIRUVHYHUDOH[FHSWLRQVWRDULVHDWWKHVDPHWLPH,IWKLVKDSSHQVWKH\DUHGHDOWZLWKLQDIL[HGRUGHU 6HH([FHSWLRQ3ULRULWLHVRQSDJH $FWLRQRQ(QWHULQJDQ([FHSWLRQ :KHQKDQGOLQJDQH[FHSWLRQWKH$507'0, 3UHVHUYHVWKHDGGUHVVRIWKHQH[WLQVWUXFWLRQLQWKHDSSURSULDWH/LQN5HJLVWHU,IWKH H[FHSWLRQKDVEHHQHQWHUHGIURP$50VWDWHWKHQWKHDGGUHVVRIWKHQH[WLQVWUXFWLRQLV FRSLHGLQWRWKH/LQN5HJLVWHUWKDWLVFXUUHQW3&RU3&GHSHQGLQJRQWKH H[FHSWLRQ6HH7DEOHRQIRUGHWDLOV,IWKHH[FHSWLRQKDVEHHQHQWHUHGIURP 7+80%VWDWHWKHQWKHYDOXHZULWWHQLQWRWKH/LQN5HJLVWHULVWKHFXUUHQW3&RIIVHWE\D YDOXHVXFKWKDWWKHSURJUDPUHVXPHVIURPWKHFRUUHFWSODFHRQUHWXUQIURPWKH H[FHSWLRQ7KLVPHDQVWKDWWKHH[FHSWLRQKDQGOHUQHHGQRWGHWHUPLQHZKLFKVWDWHWKH H[FHSWLRQZDVHQWHUHGIURP)RUH[DPSOHLQWKHFDVHRI6:,02963&5BVYFZLOO DOZD\VUHWXUQWRWKHQH[WLQVWUXFWLRQUHJDUGOHVVRIZKHWKHUWKH6:,ZDVH[HFXWHGLQ $50RU7+80%VWDWH &RSLHVWKH&365LQWRWKHDSSURSULDWH6365 )RUFHVWKH&365PRGHELWVWRDYDOXHZKLFKGHSHQGVRQWKHH[FHSWLRQ )RUFHVWKH3&WRIHWFKWKHQH[WLQVWUXFWLRQIURPWKHUHOHYDQWH[FHSWLRQYHFWRU ,WPD\DOVRVHWWKHLQWHUUXSWGLVDEOHIODJVWRSUHYHQWRWKHUZLVHXQPDQDJHDEOHQHVWLQJVRIH[FHSWLRQV ,IWKHSURFHVVRULVLQ7+80%VWDWHZKHQDQH[FHSWLRQRFFXUVLWZLOODXWRPDWLFDOO\VZLWFKLQWR$50VWDWHZKHQWKH 3&LVORDGHGZLWKWKHH[FHSWLRQYHFWRUDGGUHVV $FWLRQRQ/HDYLQJDQ([FHSWLRQ 2QFRPSOHWLRQWKHH[FHSWLRQKDQGOHU 0RYHVWKH/LQN5HJLVWHUPLQXVDQRIIVHWZKHUHDSSURSULDWHWRWKH3&7KHRIIVHWZLOO YDU\GHSHQGLQJRQWKHW\SHRIH[FHSWLRQ &RSLHVWKH6365EDFNWRWKH&365 &OHDUVWKHLQWHUUXSWGLVDEOHIODJVLIWKH\ZHUHVHWRQHQWU\ 127( $QH[SOLFLWVZLWFKEDFNWR7+80%VWDWHLVQHYHUQHHGHGVLQFHUHVWRULQJWKH&365IURPWKH6365 DXWRPDWLFDOO\VHWVWKH7ELWWRWKHYDOXHLWKHOGLPPHGLDWHO\SULRUWRWKHH[FHSWLRQ .6&5,6&0,&52&21752//(5 352*5$00(5602'(/ ([FHSWLRQ(QWU\([LW6XPPDU\ 7DEOHVXPPDULVHVWKH3&YDOXHSUHVHUYHGLQWKHUHOHYDQW5RQH[FHSWLRQHQWU\DQGWKHUHFRPPHQGHG LQVWUXFWLRQIRUH[LWLQJWKHH[FHSWLRQKDQGOHU 7DEOH([FHSWLRQ(QWU\([LW 5HWXUQ,QVWUXFWLRQ 3UHYLRXV6WDWH $50 5B[ 7+80% 5B[ 3& 3& 3& 3& 3& 3& 3& 1RWHV %/ 6:, 8'() ),4 ,54 3$%7 '$%7 5(6(7 0293&5 02963&5BVYF 02963&5BXQG 68%63&5BILT 68%63&5BLUT 68%63&5BDEW 68%63&5BDEW 1$ 3& 3& 3& 3& 3& 3& 3& 127(6 :KHUH3&LVWKHDGGUHVVRIWKH%/6:,8QGHILQHG,QVWUXFWLRQIHWFKZKLFKKDGWKHSUHIHWFKDERUW :KHUH3&LVWKHDGGUHVVRIWKHLQVWUXFWLRQZKLFKGLGQRWJHWH[HFXWHGVLQFHWKH),4RU,54WRRNSULRULW\ :KHUH3&LVWKHDGGUHVVRIWKH/RDGRU6WRUHLQVWUXFWLRQZKLFKJHQHUDWHGWKHGDWDDERUW 7KHYDOXHVDYHGLQ5BVYFXSRQUHVHWLVXQSUHGLFWDEOH ),4 7KH),4)DVW,QWHUUXSW5HTXHVWH[FHSWLRQLVGHVLJQHGWRVXSSRUWDGDWDWUDQVIHURUFKDQQHOSURFHVVDQGLQ$50 VWDWHKDVVXIILFLHQWSULYDWHUHJLVWHUVWRUHPRYHWKHQHHGIRUUHJLVWHUVDYLQJWKXVPLQLPLVLQJWKHRYHUKHDGRIFRQWH[W VZLWFKLQJ ),4LVH[WHUQDOO\JHQHUDWHGE\WDNLQJWKHQ),4LQSXW/2:7KLVLQSXWFDQH[FHSWHLWKHUV\QFKURQRXVRU DV\QFKURQRXVWUDQVLWLRQVGHSHQGLQJRQWKHVWDWHRIWKH,6<1&LQSXWVLJQDO:KHQ,6<1&LV/2:Q),4DQGQ,54 DUHFRQVLGHUHGDV\QFKURQRXVDQGDF\FOHGHOD\IRUV\QFKURQL]DWLRQLVLQFXUUHGEHIRUHWKHLQWHUUXSWFDQDIIHFWWKH SURFHVVRUIORZ ,UUHVSHFWLYHRIZKHWKHUWKHH[FHSWLRQZDVHQWHUHGIURP$50RU7KXPEVWDWHD),4KDQGOHUVKRXOGOHDYHWKH LQWHUUXSWE\H[HFXWLQJ 68%63&5BILT ),4PD\EHGLVDEOHGE\VHWWLQJWKH&365V)IODJEXWQRWHWKDWWKLVLVQRWSRVVLEOHIURP8VHUPRGH,IWKH)IODJLV FOHDU$507'0,FKHFNVIRUD/2:OHYHORQWKHRXWSXWRIWKH),4V\QFKURQLVHUDWWKHHQGRIHDFKLQVWUXFWLRQ 352*5$00(5602'(/ .6&5,6&0,&52&21752/(5 ,54 7KH,54,QWHUUXSW5HTXHVWH[FHSWLRQLVDQRUPDOLQWHUUXSWFDXVHGE\D/2:OHYHORQWKHQ,54LQSXW,54KDVD ORZHUSULRULW\WKDQ),4DQGLVPDVNHGRXWZKHQD),4VHTXHQFHLVHQWHUHG,WPD\EHGLVDEOHGDWDQ\WLPHE\ VHWWLQJWKH,ELWLQWKH&365WKRXJKWKLVFDQRQO\EHGRQHIURPDSULYLOHJHGQRQ8VHUPRGH ,UUHVSHFWLYHRIZKHWKHUWKHH[FHSWLRQZDVHQWHUHGIURP$50RU7KXPEVWDWHDQ,54KDQGOHUVKRXOGUHWXUQIURP WKHLQWHUUXSWE\H[HFXWLQJ 68%63&5BLUT $ERUW $QDERUWLQGLFDWHVWKDWWKHFXUUHQWPHPRU\DFFHVVFDQQRWEHFRPSOHWHG,WFDQEHVLJQDOOHGE\WKHH[WHUQDO $%257LQSXW$507'0,FKHFNVIRUWKHDERUWH[FHSWLRQGXULQJPHPRU\DFFHVVF\FOHV 7KHUHDUHWZRW\SHVRIDERUW 3UHIHWFKDERUWRFFXUVGXULQJDQLQVWUXFWLRQSUHIHWFK 'DWDDERUWRFFXUVGXULQJDGDWDDFFHVV ,IDSUHIHWFKDERUWRFFXUVWKHSUHIHWFKHGLQVWUXFWLRQLVPDUNHGDVLQYDOLGEXWWKHH[FHSWLRQZLOOQRWEHWDNHQXQWLO WKHLQVWUXFWLRQUHDFKHVWKHKHDGRIWKHSLSHOLQH,IWKHLQVWUXFWLRQLVQRWH[HFXWHGIRUH[DPSOHEHFDXVHDEUDQFK RFFXUVZKLOHLWLVLQWKHSLSHOLQHWKHDERUWGRHVQRWWDNHSODFH ,IDGDWDDERUWRFFXUVWKHDFWLRQWDNHQGHSHQGVRQWKHLQVWUXFWLRQW\SH 6LQJOHGDWDWUDQVIHULQVWUXFWLRQV/'5675ZULWHEDFNPRGLILHGEDVHUHJLVWHUVWKH$ERUWKDQGOHUPXVWEH DZDUHRIWKLV 7KHVZDSLQVWUXFWLRQ6:3LVDERUWHGDVWKRXJKLWKDGQRWEHHQH[HFXWHG %ORFNGDWDWUDQVIHULQVWUXFWLRQV/'0670FRPSOHWH,IZULWHEDFNLVVHWWKHEDVHLVXSGDWHG,IWKHLQVWUXFWLRQ ZRXOGKDYHRYHUZULWWHQWKHEDVHZLWKGDWDLHLWKDVWKHEDVHLQWKHWUDQVIHUOLVWWKHRYHUZULWLQJLVSUHYHQWHG $OOUHJLVWHURYHUZULWLQJLVSUHYHQWHGDIWHUDQDERUWLVLQGLFDWHGZKLFKPHDQVLQSDUWLFXODUWKDW5DOZD\VWKH ODVWUHJLVWHUWREHWUDQVIHUUHGLVSUHVHUYHGLQDQDERUWHG/'0LQVWUXFWLRQ 7KHDERUWPHFKDQLVPDOORZVWKHLPSOHPHQWDWLRQRIDGHPDQGSDJHGYLUWXDOPHPRU\V\VWHP,QVXFKDV\VWHPWKH SURFHVVRULVDOORZHGWRJHQHUDWHDUELWUDU\DGGUHVVHV:KHQWKHGDWDDWDQDGGUHVVLVXQDYDLODEOHWKH0HPRU\ 0DQDJHPHQW8QLW008VLJQDOVDQDERUW7KHDERUWKDQGOHUPXVWWKHQZRUNRXWWKHFDXVHRIWKHDERUWPDNHWKH UHTXHVWHGGDWDDYDLODEOHDQGUHWU\WKHDERUWHGLQVWUXFWLRQ7KHDSSOLFDWLRQSURJUDPQHHGVQRNQRZOHGJHRIWKH DPRXQWRIPHPRU\DYDLODEOHWRLWQRULVLWVVWDWHLQDQ\ZD\DIIHFWHGE\WKHDERUW $IWHUIL[LQJWKHUHDVRQIRUWKHDERUWWKHKDQGOHUVKRXOGH[HFXWHWKHIROORZLQJLUUHVSHFWLYHRIWKHVWDWH$50RU 7KXPE 68%63&5BDEW 68%63&5BDEW IRUDSUHIHWFKDERUWRU IRUDGDWDDERUW 7KLVUHVWRUHVERWKWKH3&DQGWKH&365DQGUHWULHVWKHDERUWHGLQVWUXFWLRQ .6&5,6&0,&52&21752//(5 352*5$00(5602'(/ 6RIWZDUH,QWHUUXSW 7KHVRIWZDUHLQWHUUXSWLQVWUXFWLRQ6:,LVXVHGIRUHQWHULQJ6XSHUYLVRUPRGHXVXDOO\WRUHTXHVWDSDUWLFXODU VXSHUYLVRUIXQFWLRQ$6:,KDQGOHUVKRXOGUHWXUQE\H[HFXWLQJWKHIROORZLQJLUUHVSHFWLYHRIWKHVWDWH$50RU 7KXPE 0293&5BVYF 7KLVUHVWRUHVWKH3&DQG&365DQGUHWXUQVWRWKHLQVWUXFWLRQIROORZLQJWKH6:, 127( Q),4Q,54,6<1&/2&.%,*(1'DQG$%257SLQVH[LVWRQO\LQWKHLQWHUQDO$507'0,&38FRUH 8QGHILQHG,QVWUXFWLRQ :KHQ$507'0,FRPHVDFURVVDQLQVWUXFWLRQZKLFKLWFDQQRWKDQGOHLWWDNHVWKHXQGHILQHGLQVWUXFWLRQWUDS7KLV PHFKDQLVPPD\EHXVHGWRH[WHQGHLWKHUWKH7+80%RU$50LQVWUXFWLRQVHWE\VRIWZDUHHPXODWLRQ $IWHUHPXODWLQJWKHIDLOHGLQVWUXFWLRQWKHWUDSKDQGOHUVKRXOGH[HFXWHWKHIROORZLQJLUUHVSHFWLYHRIWKHVWDWH$50RU 7KXPE 02963&5BXQG 7KLVUHVWRUHVWKH&365DQGUHWXUQVWRWKHLQVWUXFWLRQIROORZLQJWKHXQGHILQHGLQVWUXFWLRQ ([FHSWLRQ9HFWRUV 7KHIROORZLQJWDEOHVKRZVWKHH[FHSWLRQYHFWRUDGGUHVVHV 7DEOH([FHSWLRQ9HFWRUV $GGUHVV [ [ [ [& [ [ [ [& 5HVHW 8QGHILQHGLQVWUXFWLRQ 6RIWZDUHLQWHUUXSW $ERUWSUHIHWFK $ERUWGDWD 5HVHUYHG ,54 ),4 ([FHSWLRQ 0RGHRQHQWU\ 6XSHUYLVRU 8QGHILQHG 6XSHUYLVRU $ERUW $ERUW 5HVHUYHG ,54 ),4 352*5$00(5602'(/ .6&5,6&0,&52&21752/(5 ([FHSWLRQ3ULRULWLHV :KHQPXOWLSOHH[FHSWLRQVDULVHDWWKHVDPHWLPHDIL[HGSULRULW\V\VWHPGHWHUPLQHVWKHRUGHULQZKLFKWKH\DUH KDQGOHG +LJKHVWSULRULW\ 5HVHW 'DWDDERUW ),4 ,54 3UHIHWFKDERUW /RZHVWSULRULW\ 8QGHILQHG,QVWUXFWLRQ6RIWZDUHLQWHUUXSW 1RW$OO([FHSWLRQV&DQ2FFXUDW2QFH 8QGHILQHG,QVWUXFWLRQDQG6RIWZDUH,QWHUUXSWDUHPXWXDOO\H[FOXVLYHVLQFHWKH\HDFKFRUUHVSRQGWRSDUWLFXODUQRQ RYHUODSSLQJGHFRGLQJVRIWKHFXUUHQWLQVWUXFWLRQ ,IDGDWDDERUWRFFXUVDWWKHVDPHWLPHDVD),4DQG),4VDUHHQDEOHGLHWKH&365V)IODJLVFOHDU$507'0, HQWHUVWKHGDWDDERUWKDQGOHUDQGWKHQLPPHGLDWHO\SURFHHGVWRWKH),4YHFWRU$QRUPDOUHWXUQIURP),4ZLOOFDXVH WKHGDWDDERUWKDQGOHUWRUHVXPHH[HFXWLRQ3ODFLQJGDWDDERUWDWDKLJKHUSULRULW\WKDQ),4LVQHFHVVDU\WRHQVXUH WKDWWKHWUDQVIHUHUURUGRHVQRWHVFDSHGHWHFWLRQ7KHWLPHIRUWKLVH[FHSWLRQHQWU\VKRXOGEHDGGHGWRZRUVWFDVH ),4ODWHQF\FDOFXODWLRQV ,17(55837/$7(1&,(6 7KHZRUVWFDVHODWHQF\IRU),4DVVXPLQJWKDWLWLVHQDEOHGFRQVLVWVRIWKHORQJHVWWLPHWKHUHTXHVWFDQWDNHWRSDVV WKURXJKWKHV\QFKURQLVHU7V\QFPD[LIDV\QFKURQRXVSOXVWKHWLPHIRUWKHORQJHVWLQVWUXFWLRQWRFRPSOHWH7OGP WKHORQJHVWLQVWUXFWLRQLVDQ/'0ZKLFKORDGVDOOWKHUHJLVWHUVLQFOXGLQJWKH3&SOXVWKHWLPHIRUWKHGDWDDERUWHQWU\ 7H[FSOXVWKHWLPHIRU),4HQWU\7ILT$WWKHHQGRIWKLVWLPH$507'0,ZLOOEHH[HFXWLQJWKHLQVWUXFWLRQDW[& 7V\QFPD[LVSURFHVVRUF\FOHV7OGPLVF\FOHV7H[FLVF\FOHVDQG7ILTLVF\FOHV7KHWRWDOWLPHLVWKHUHIRUH SURFHVVRUF\FOHV7KLVLVMXVWRYHUPLFURVHFRQGVLQDV\VWHPZKLFKXVHVDFRQWLQXRXV0+]SURFHVVRU FORFN7KHPD[LPXP,54ODWHQF\FDOFXODWLRQLVVLPLODUEXWPXVWDOORZIRUWKHIDFWWKDW),4KDVKLJKHUSULRULW\DQG FRXOGGHOD\HQWU\LQWRWKH,54KDQGOLQJURXWLQHIRUDQDUELWUDU\OHQJWKRIWLPH7KHPLQLPXPODWHQF\IRU),4RU,54 FRQVLVWVRIWKHVKRUWHVWWLPHWKHUHTXHVWFDQWDNHWKURXJKWKHV\QFKURQLVHU7V\QFPLQSOXV7ILT7KLVLV SURFHVVRUF\FOHV 5(6(7 :KHQWKHQ5(6(7VLJQDOJRHV/2:$507'0,DEDQGRQVWKHH[HFXWLQJLQVWUXFWLRQDQGWKHQFRQWLQXHVWRIHWFK LQVWUXFWLRQVIURPLQFUHPHQWLQJZRUGDGGUHVVHV :KHQQ5(6(7JRHV+,*+DJDLQ$507'0, 2YHUZULWHV5BVYFDQG6365BVYFE\FRS\LQJWKHFXUUHQWYDOXHVRIWKH3&DQG&365LQWRWKHP7KHYDOXHRI WKHVDYHG3&DQG6365LVQRWGHILQHG )RUFHV0>@WR6XSHUYLVRUPRGHVHWVWKH,DQG)ELWVLQWKH&365DQGFOHDUVWKH&365V7ELW )RUFHVWKH3&WRIHWFKWKHQH[WLQVWUXFWLRQIURPDGGUHVV[ ([HFXWLRQUHVXPHVLQ$50VWDWH .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 ,QVWUXFWLRQVHW ,16758&7,216(76800$< 7KLVFKDSWHUGHVFULEHVWKH$50LQVWUXFWLRQVHWDQGWKH7+80%LQVWUXFWLRQVHWLQWKH$507'0,FRUH )250$76800$5< 7KH$50LQVWUXFWLRQVHWIRUPDWVDUHVKRZQEHORZ 'DWD3URFHVVLQJ 3657UDQVIHU 0XOWLSO\ 0XOWLSO\/RQJ 6LQJOH'DWD6ZDS %UDQFKDQG([FKDQJH +DOIZRUG'DWD7UDQIHU UHJLVWHURIIVHW +DOIZRUG'DWD7UDQVIHU LPPHGLDWHRIIVHW 6LQJOH'DWD7UDQVIHU 8QGHILQHG %ORFN'DWD7UDQVIHU %UDQFK &RSURFHVVRU'DWD 7UDQVIHU &RSURFHVVRU'DWD 2SHUDWLRQ &RSURFHVVRU5HJLVWHU 7UDQVIHU 6RIWZDUH,QWHUUXSW !" )LJXUH$50,QVWUXFWLRQ6HW)RUPDW 127( 6RPHLQVWUXFWLRQFRGHVDUHQRWGHILQHGEXWGRQRWFDXVHWKH8QGHILQHGLQVWUXFWLRQWUDSWREHWDNHQIRU LQVWDQFHD0XOWLSO\LQVWUXFWLRQZLWKELWFKDQJHGWRD7KHVHLQVWUXFWLRQVVKRXOGQRWEHXVHGDVWKHLU DFWLRQPD\FKDQJHLQIXWXUH$50LPSOHPHQWDWLRQV $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,216800$5< 7DEOH7KH$50,QVWUXFWLRQ6HW 0QHPRQLF $'& $'' $1' % %,& %/ %; &'3 &01 &03 (25 /'& /'0 /'5 0&5 0/$ 029 05& 056 065 08/ 091 255 56% 56& $GG $1' %UDQFK %LW&OHDU %UDQFKZLWK/LQN %UDQFKDQG([FKDQJH &RSURFHVRU'DWD 3URFHVVLQJ &RPSDUH1HJDWLYH &RPSDUH ([FOXVLYH25 /RDGFRSURFHVVRUIURP PHPRU\ /RDGPXOWLSOHUHJLVWHUV 0RYH&38UHJLVWHUWR FRSURFHVVRUUHJLVWHU 0XOWLSO\$FFXPXODWH 0RYHUHJLVWHURUFRQVWDQW 0RYHIURPFRSURFHVVRU UHJLVWHUWR&38UHJLVWHU 0RYH365VWDWXVIODJVWR UHJLVWHU 0RYHUHJLVWHUWR365 VWDWXVIODJV 0XOWLSO\ 0RYHQHJDWLYHUHJLVWHU 25 5HYHUVH6XEWUDFW 5HYHUVH6XEWUDFWZLWK &DUU\ ,QVWUXFWLRQ $GGZLWKFDUU\ $FWLRQ 5G 5Q2S&DUU\ 5G 5Q2S 5G 5Q$1'2S 5 DGGUHVV 5G 5Q$1'1272S 5 55 DGGUHVV 5 5Q 7ELW 5Q>@ &RSURFHVVRUVSHFLILF &365IODJV 5Q2S &365IODJV 5Q2S 5G 5Q$1'1272S 25RS$1'1275Q &RSURFHVVRUORDG 6WDFNPDQLSXODWLRQ3RS F5Q U5Q^RS!F5P` 5G 5P5V5Q 5G 2S 5Q F5Q^RS!F5P` 5Q 365 365 5P 5G 5P5V 5G [))))))))(25 2S 5G 5Q252S 5G 2S5Q 5G 2S5Q&DUU\ /RDGUHJLVWHUIURPPHPRU\ 5G DGGUHVV .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 7DEOH7KH$50,QVWUXFWLRQ6HW&RQWLQXHG 0QHPRQLF 6%& 67& 670 675 68% 6:, 6:3 7(4 767 ,QVWUXFWLRQ 6XEWUDFWZLWK&DUU\ $FWLRQ 5G 5Q2S&DUU\ 6WRUHFRSURFHVVRUUHJLVWHU DGGUHVV &5Q WRPHPRU\ 6WRUH0XOWLSOH 6WRUHUHJLVWHUWRPHPRU\ 6XEWUDFW 6RIWZDUH,QWHUUXSW 6ZDSUHJLVWHUZLWK PHPRU\ 7HVWELWZLVHHTXDOLW\ 7HVWELWV 6WDFNPDQLSXODWLRQ3XVK DGGUHVV! 5G 5G 5Q2S 26FDOO 5G >5Q@>5Q@ 5P &365IODJV 5Q(252S &365IODJV 5Q$1'2S $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 7+(&21',7,21),(/' ,Q$50VWDWHDOOLQVWUXFWLRQVDUHFRQGLWLRQDOO\H[HFXWHGDFFRUGLQJWRWKHVWDWHRIWKH&365FRQGLWLRQFRGHVDQGWKH LQVWUXFWLRQVFRQGLWLRQILHOG7KLVILHOGELWVGHWHUPLQHVWKHFLUFXPVWDQFHVXQGHUZKLFKDQLQVWUXFWLRQLVWREH H[HFXWHG,IWKHVWDWHRIWKH&1=DQG9IODJVIXOILOVWKHFRQGLWLRQVHQFRGHGE\WKHILHOGWKHLQVWUXFWLRQLV H[HFXWHGRWKHUZLVHLWLVLJQRUHG 7KHUHDUHVL[WHHQSRVVLEOHFRQGLWLRQVHDFKUHSUHVHQWHGE\DWZRFKDUDFWHUVXIIL[WKDWFDQEHDSSHQGHGWRWKH LQVWUXFWLRQVPQHPRQLF)RUH[DPSOHD%UDQFKLQDVVHPEO\ODQJXDJHEHFRPHVIRU%UDQFKLI(TXDO ZKLFKPHDQVWKH%UDQFKZLOORQO\EHWDNHQLIWKH=IODJLVVHW ,QSUDFWLFHILIWHHQGLIIHUHQWFRQGLWLRQVPD\EHXVHGWKHVHDUHOLVWHGLQ7DEOH7KHVL[WHHQWKLVUHVHUYHG DQGPXVWQRWEHXVHG ,QWKHDEVHQFHRIDVXIIL[WKHFRQGLWLRQILHOGRIPRVWLQVWUXFWLRQVLVVHWWR$OZD\VVXIL[$/7KLVPHDQVWKH LQVWUXFWLRQZLOODOZD\VEHH[HFXWHGUHJDUGOHVVRIWKH&365FRQGLWLRQFRGHV 7DEOH&RQGLWLRQ&RGH6XPPDU\ &RGH 6XIIL[ (4 1( &6 && 0, 3/ 96 9& +, /6 *( /7 *7 /( $/ =VHW =FOHDU &VHW &FOHDU 1VHW 1FOHDU 9VHW 9FOHDU &VHWDQG=FOHDU &FOHDURU=VHW 1HTXDOV9 1QRWHTXDOWR9 =FOHDU$1'1HTXDOV9 =VHW251QRWHTXDOWR9 LJQRUHG )ODJV HTXDO QRWHTXDO XQVLJQHGKLJKHURUVDPH XQVLJQHGORZHU QHJDWLYH SRVLWLYHRU]HUR RYHUIORZ QRRYHUIORZ XQVLJQHGKLJKHU XQVLJQHGORZHURUVDPH JUHDWHURUHTXDO OHVVWKDQ JUHDWHUWKDQ OHVVWKDQRUHTXDO DOZD\V 0HDQLQJ .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 %5$1&+$1'(;&+$1*(%; 7KLVLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH 7KLVLQVWUXFWLRQSHUIRUPVDEUDQFKE\FRS\LQJWKHFRQWHQWVRIDJHQHUDOUHJLVWHU5QLQWRWKHSURJUDPFRXQWHU3& 7KHEUDQFKFDXVHVDSLSHOLQHIOXVKDQGUHILOOIURPWKHDGGUHVVVSHFLILHGE\5Q7KLVLQVWUXFWLRQDOVRSHUPLWVWKH LQVWUXFWLRQVHWWREHH[FKDQJHG:KHQWKHLQVWUXFWLRQLVH[HFXWHGWKHYDOXHRI5Q>@GHWHUPLQHVZKHWKHUWKH LQVWUXFWLRQVWUHDPZLOOEHGHFRGHGDV$50RU7+80%LQVWUXFWLRQV &RQG 5Q >@2SHUDQGUHJLVWHU ,IELWRI5Q VXEVHTXHQWLQVWUXFWLRQVGHFRGHGDV7+80%LQVWUXFWLRQV ,IELWRI5Q VXEVHTXHQWLQVWUXFWLRQVGHFRGHGDV$50LQVWUXFWLRQV >@&RQGLWLRQ)LHOG )LJXUH%UDQFKDQG([FKDQJH,QVWUXFWLRQV ,16758&7,21&<&/(7,0(6 7KH%;LQVWUXFWLRQWDNHV61F\FOHVWRH[HFXWHZKHUH6DQG1DUHGHILQHGDVVHTXHQWLDO6F\FOHDQGQRQ VHTXHQFLDO1F\FOHUHVSHFWLYHO\ $66(0%/(56<17$; %;EUDQFKDQGH[FKDQJH %;^FRQG`5Q ^FRQG` 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH 5Q LVDQH[SUHVVLRQHYDOXDWLQJWRDYDOLGUHJLVWHUQXPEHU 86,1*5$6$123(5$1' ,I5LVXVHGDVDQRSHUDQGWKHEHKDYLRXULVXQGHILQHG $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 ([DPSOHV $'5 5,QWRB7+80% *HQHUDWHEUDQFKWDUJHWDGGUHVV DQGVHWELWKLJKKHQFH DUULYHLQ7+80%VWDWH %UDQFKDQGFKDQJHWR7+80% VWDWH $VVHPEOHVXEVHTXHQWFRGHDV 7+80%LQVWUXFWLRQV %; 5 &2'( ,QWRB7+80% $'55%DFNBWRB$50 %;5 $/,*1 &2'( %DFNBWRB$50 *HQHUDWHEUDQFKWDUJHWWRZRUGDOLJQHGDGGUHVV KHQFHELWLVORZDQGVRFKDQJHEDFNWR$50VWDWH %UDQFKDQGFKDQJHEDFNWR$50VWDWH :RUGDOLJQ $VVHPEOHVXEVHTXHQWFRGHDV$50LQVWUXFWLRQV .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 %5$1&+$1'%5$1&+:,7+/,1.%%/ 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHG7DEOH7KHLQVWUXFWLRQ HQFRGLQJLVVKRZQLQ)LJXUHEHORZ &RQG / RIIVHW >@/LQNELW %UDQFK %UDQFKZLWKOLQN >@&RQGLWLRQILHOG )LJXUH%UDQFK,QVWUXFWLRQV %UDQFKLQVWUXFWLRQVFRQWDLQDVLJQHGVFRPSOHPHQWELWRIIVHW7KLVLVVKLIWHGOHIWWZRELWVVLJQH[WHQGHGWR ELWVDQGDGGHGWRWKH3&7KHLQVWUXFWLRQFDQWKHUHIRUHVSHFLI\DEUDQFKRI0E\WHV7KHEUDQFKRIIVHWPXVW WDNHDFFRXQWRIWKHSUHIHWFKRSHUDWLRQZKLFKFDXVHVWKH3&WREHZRUGVE\WHVDKHDGRIWKHFXUUHQW LQVWUXFWLRQ %UDQFKHVEH\RQG0E\WHVPXVWXVHDQRIIVHWRUDEVROXWHGHVWLQDWLRQZKLFKKDVEHHQSUHYLRXVO\ORDGHGLQWRD UHJLVWHU,QWKLVFDVHWKH3&VKRXOGEHPDQXDOO\VDYHGLQ5LID%UDQFKZLWK/LQNW\SHRSHUDWLRQLVUHTXLUHG 7+(/,1.%,7 %UDQFKZLWK/LQN%/ZULWHVWKHROG3&LQWRWKHOLQNUHJLVWHU5RIWKHFXUUHQWEDQN7KH3&YDOXHZULWWHQLQWR 5LVDGMXVWHGWRDOORZIRUWKHSUHIHWFKDQGFRQWDLQVWKHDGGUHVVRIWKHLQVWUXFWLRQIROORZLQJWKHEUDQFKDQGOLQN LQVWUXFWLRQ1RWHWKDWWKH&365LVQRWVDYHGZLWKWKH3&DQG5>@DUHDOZD\VFOHDUHG 7RUHWXUQIURPDURXWLQHFDOOHGE\%UDQFKZLWK/LQNXVH0293&5LIWKHOLQNUHJLVWHULVVWLOOYDOLGRU/'0 5Q^3&`LIWKHOLQNUHJLVWHUKDVEHHQVDYHGRQWRDVWDFNSRLQWHGWRE\5Q ,16758&7,21&<&/(7,0(6 %UDQFKDQG%UDQFKZLWK/LQNLQVWUXFWLRQVWDNH61LQFUHPHQWDOF\FOHVZKHUH6DQG1DUHGHILQHGDVVTXHQWLDO 6F\FOHDQGLQWHUQDO,F\FOH $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 $66(0%/(56<17$; ,WHPVLQ^`DUHRSWLRQDO,WHPVLQ!PXVWEHSUHVHQW %^/`^FRQG`H[SUHVVLRQ! ^/` ^FRQG` H[SUHVVLRQ! (;$03/(6 KHUH %$/ % &03 %(4 %/ $''6 %/&& KHUH WKHUH 5 IUHG VXE520 5 VXE $VVHPEOHVWR[($)))))(QRWHHIIHFWRI3&RIIVHW $OZD\VFRQGLWLRQXVHGDVGHIDXOW &RPSDUH5ZLWK]HURDQGEUDQFKWRIUHG LI5ZDV]HURRWKHUZLVHFRQWLQXH &RQWLQXHWRQH[WLQVWUXFWLRQ &DOOVXEURXWLQHDWFRPSXWHGDGGUHVV $GGWRUHJLVWHUVHWWLQJ&365IODJV RQWKHUHVXOWWKHQFDOOVXEURXWLQHLI WKH&IODJLVFOHDUZKLFKZLOOEHWKH FDVHXQOHVV5KHOG[)))))))) 8VHGWRUHTXHVWWKH%UDQFKZLWK/LQNIRUPRIWKHLQVWUXFWLRQ,IDEVHQW5ZLOOQRWEH DIIHFWHGE\WKHLQVWUXFWLRQ $WZRFKDUDFWHUPQHPRQLFDVVKRZQLQ7DEOH,IDEVHQWWKHQ$/$/ZD\VZLOOEH XVHG 7KHGHVWLQDWLRQ7KHDVVHPEOHUFDOFXODWHVWKHRIIVHW .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 '$7$352&(66,1* 7KHGDWDSURFHVVLQJLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH &RQG , 2S&RGH 6 5Q 5G 2SHUDQG >@'HVWLQDWLRQUHJLVWHU %UDQFK %UDQFK %UDQFKZLWK/LQN %UDQFKZLWK/LQN 6HWFRQGLWLRQFRGHV >@VWRSHUDQGUHJLVWHU >@6HWFRQGLWLRQFRGHV >@2SHUDWLRQFRGH 'RQRWDIWHUFRQGLWLRQFRGHV $1'5G 2S$1'2S (255G 2S(252S 68%5G 2S2S 56%5G 2S2S $''5G 2S2S $'&5G 2S2S& 6%&5G 2S2S& 56&5G 2S2S& 767VHWFRQGLWLRQFRGHVRQ2S$1'2S 7(2VHWFRQGLWLRQFRGHVRQ2S(252S &03VHWFRQGLWLRQFRGHVRQ2S2S 601VHWFRQGLWLRQFRGHVRQ2S2S 2555G 2S252S 0295G 2S %,&5G 2S$1'1272S 0915G 1272S 2SHUDQGLVDQ,PPHGLDWH9DOXH >@,PPHGLDWHRSHUDQG 2SHUDQGLVDUHJLVWHU >@2SHUDQGW\SHVHOHFWLRQ 6KLIW >@QG2SHUDQG5HJLVWHU 5P >@6KLIW$SSOLHGWR5P 5RWDWH ,PP >@6KLIWDSSOLHGWROPP >@8QVLJQHGELWLPPHGLDWHYDOXH >@&RQGLWLRQILHOG )LJXUH'DWD3URFHVVLQJ,QVWUXFWLRQV $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 7KHLQVWUXFWLRQSURGXFHVDUHVXOWE\SHUIRUPLQJDVSHFLILHGDULWKPHWLFRUORJLFDORSHUDWLRQRQRQHRUWZRRSHUDQGV 7KHILUVWRSHUDQGLVDOZD\VDUHJLVWHU5Q 7KHVHFRQGRSHUDQGPD\EHDVKLIWHGUHJLVWHU5PRUDURWDWHGELWLPPHGLDWHYDOXH,PPDFFRUGLQJWRWKHYDOXH RIWKH,ELWLQWKHLQVWUXFWLRQ7KHFRQGLWLRQFRGHVLQWKH&365PD\EHSUHVHUYHGRUXSGDWHGDVDUHVXOWRIWKLV LQVWUXFWLRQDFFRUGLQJWRWKHYDOXHRIWKH6ELWLQWKHLQVWUXFWLRQ &HUWDLQRSHUDWLRQV7677(4&03&01GRQRWZULWHWKHUHVXOWWR5G7KH\DUHXVHGRQO\WRSHUIRUPWHVWVDQGWR VHWWKHFRQGLWLRQFRGHVRQWKHUHVXOWDQGDOZD\VKDYHWKH6ELWVHW7KHLQVWUXFWLRQVDQGWKHLUHIIHFWVDUHOLVWHGLQ 7DEOH .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 &365)/$*6 7KHGDWDSURFHVVLQJRSHUDWLRQVPD\EHFODVVLILHGDVORJLFDORUDULWKPHWLF7KHORJLFDORSHUDWLRQV$1'(25767 7(4255029%,&091SHUIRUPWKHORJLFDODFWLRQRQDOOFRUUHVSRQGLQJELWVRIWKHRSHUDQGRURSHUDQGVWR SURGXFHWKHUHVXOW,IWKH6ELWLVVHWDQG5GLVQRW5VHHEHORZWKH9IODJLQWKH&365ZLOOEHXQDIIHFWHGWKH& IODJZLOOEHVHWWRWKHFDUU\RXWIURPWKHEDUUHOVKLIWHURUSUHVHUYHGZKHQWKHVKLIWRSHUDWLRQLV/6/WKH=IODJZLOO EHVHWLIDQGRQO\LIWKHUHVXOWLVDOO]HURVDQGWKH1IODJZLOOEHVHWWRWKHORJLFDOYDOXHRIELWRIWKHUHVXOW 7DEOH$50'DWD3URFHVVLQJ,QVWUXFWLRQV $VVHPEOHU 0QHPRQLF $1' (25 68% 56% $'' $'& 6%& 56& 767 7(4 &03 &01 255 029 %,& 091 2S&RGH $FWLRQ 2SHUDQG$1'RSHUDQG 2SHUDQG(25RSHUDQG 2SHUDQGRSHUDQG 2SHUDQGRSHUDQG 2SHUDQGRSHUDQG 2SHUDQGRSHUDQGFDUU\ 2SHUDQGRSHUDQGFDUU\ 2SHUDQGRSHUDQGFDUU\ $V$1'EXWUHVXOWLVQRWZULWWHQ $V(25EXWUHVXOWLVQRWZULWWHQ $V68%EXWUHVXOWLVQRWZULWWHQ $V$''EXWUHVXOWLVQRWZULWWHQ 2SHUDQG25RSHUDQG 2SHUDQGRSHUDQGLVLJQRUHG 2SHUDQG$1'127RSHUDQG%LWFOHDU 127RSHUDQGRSHUDQGLVLJQRUHG 7KHDULWKPHWLFRSHUDWLRQV68%56%$''$'&6%&56&&03&01WUHDWHDFKRSHUDQGDVDELWLQWHJHU HLWKHUXQVLJQHGRUVFRPSOHPHQWVLJQHGWKHWZRDUHHTXLYDOHQW,IWKH6ELWLVVHWDQG5GLVQRW5WKH9IODJ LQWKH&365ZLOOEHVHWLIDQRYHUIORZRFFXUVLQWRELWRIWKHUHVXOWWKLVPD\EHLJQRUHGLIWKHRSHUDQGVZHUH FRQVLGHUHGXQVLJQHGEXWZDUQVRIDSRVVLEOHHUURULIWKHRSHUDQGVZHUHVFRPSOHPHQWVLJQHG7KH&IODJZLOOEH VHWWRWKHFDUU\RXWRIELWRIWKH$/8WKH=IODJZLOOEHVHWLIDQGRQO\LIWKHUHVXOWZDV]HURDQGWKH1IODJZLOOEH VHWWRWKHYDOXHRIELWRIWKHUHVXOWLQGLFDWLQJDQHJDWLYHUHVXOWLIWKHRSHUDQGVDUHFRQVLGHUHGWREHV FRPSOHPHQWVLJQHG $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 6+,)76 :KHQWKHVHFRQGRSHUDQGLVVSHFLILHGWREHDVKLIWHGUHJLVWHUWKHRSHUDWLRQRIWKHEDUUHOVKLIWHULVFRQWUROOHGE\WKH 6KLIWILHOGLQWKHLQVWUXFWLRQ7KLVILHOGLQGLFDWHVWKHW\SHRIVKLIWWREHSHUIRUPHGORJLFDOOHIWRUULJKWDULWKPHWLFULJKW RUURWDWHULJKW7KHDPRXQWE\ZKLFKWKHUHJLVWHUVKRXOGEHVKLIWHGPD\EHFRQWDLQHGLQDQLPPHGLDWHILHOGLQWKH LQVWUXFWLRQRULQWKHERWWRPE\WHRIDQRWKHUUHJLVWHURWKHUWKDQ57KHHQFRGLQJIRUWKHGLIIHUHQWVKLIWW\SHVLV VKRZQLQ)LJXUH >@6KLIWW\SH ORJLFDOOHIW DULWKPHWLFULJKW ORJLFDOULJKW URWDWHULJKW 56 ORJLFDOULJKW URWDWHULJKW >@6KLIWW\SH ORJLFDOOHIW DULWKPHWLFULJKW >@6KLIWDPRXQW ELWXQVLJQHGLQWHJHU >@6KLIWUHJLVWHU 6KLIWDPRXQWVSHFLILHGLQ ERWWRPE\WHRI5V )LJXUH$506KLIW2SHUDWLRQV ,QVWUXFWLRQVSHFLILHGVKLIWDPRXQW :KHQWKHVKLIWDPRXQWLVVSHFLILHGLQWKHLQVWUXFWLRQLWLVFRQWDLQHGLQDELWILHOGZKLFKPD\WDNHDQ\YDOXHIURP WR$ORJLFDOVKLIWOHIW/6/WDNHVWKHFRQWHQWVRI5PDQGPRYHVHDFKELWE\WKHVSHFLILHGDPRXQWWRDPRUH VLJQLILFDQWSRVLWLRQ7KHOHDVWVLJQLILFDQWELWVRIWKHUHVXOWDUHILOOHGZLWK]HURVDQGWKHKLJKELWVRI5PZKLFKGRQRW PDSLQWRWKHUHVXOWDUHGLVFDUGHGH[FHSWWKDWWKHOHDVWVLJQLILFDQWGLVFDUGHGELWEHFRPHVWKHVKLIWHUFDUU\RXWSXW ZKLFKPD\EHODWFKHGLQWRWKH&ELWRIWKH&365ZKHQWKH$/8RSHUDWLRQLVLQWKHORJLFDOFODVVVHHDERYH)RU H[DPSOHWKHHIIHFWRI/6/ LVVKRZQLQ)LJXUH &RQWHQWVRI5P FDUU\RXW 9DOXHRIRSHUDQG )LJXUH/RJLFDO6KLIW/HIW 127( /6/LVDVSHFLDOFDVHZKHUHWKHVKLIWHUFDUU\RXWLVWKHROGYDOXHRIWKH&365&IODJ7KHFRQWHQWVRI 5PDUHXVHGGLUHFWO\DVWKHVHFRQGRSHUDQG$ORJLFDOVKLIWULJKW/65LVVLPLODUEXWWKHFRQWHQWVRI5P DUHPRYHGWROHVVVLJQLILFDQWSRVLWLRQVLQWKHUHVXOW/65KDVWKHHIIHFWVKRZQLQ)LJXUH .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 &RQWHQWVRI5P FDUU\RXW 9DOXHRIRSHUDQG )LJXUH/RJLFDO6KLIW5LJKW 7KHIRUPRIWKHVKLIWILHOGZKLFKPLJKWEHH[SHFWHGWRFRUUHVSRQGWR/65LVXVHGWRHQFRGH/65ZKLFKKDV D]HURUHVXOWZLWKELWRI5PDVWKHFDUU\RXWSXW/RJLFDOVKLIWULJKW]HURLVUHGXQGDQWDVLWLVWKHVDPHDVORJLFDO VKLIWOHIW]HURVRWKHDVVHPEOHUZLOOFRQYHUW/65DQG$65DQG525LQWR/6/DQGDOORZ/65WR EHVSHFLILHG $QDULWKPHWLFVKLIWULJKW$65LVVLPLODUWRORJLFDOVKLIWULJKWH[FHSWWKDWWKHKLJKELWVDUHILOOHGZLWKELWRI5P LQVWHDGRI]HURV7KLVSUHVHUYHVWKHVLJQLQVFRPSOHPHQWQRWDWLRQ)RUH[DPSOH$65LVVKRZQLQ)LJXUH &RQWHQWVRI5P FDUU\RXW 9DOXHRIRSHUDQG )LJXUH$ULWKPHWLF6KLIW5LJKW 7KHIRUPRIWKHVKLIWILHOGZKLFKPLJKWEHH[SHFWHGWRJLYH$65LVXVHGWRHQFRGH$65%LWRI5PLV DJDLQXVHGDVWKHFDUU\RXWSXWDQGHDFKELWRIRSHUDQGLVDOVRHTXDOWRELWRI5P7KHUHVXOWLVWKHUHIRUHDOO RQHVRUDOO]HURVDFFRUGLQJWRWKHYDOXHRIELWRI5P $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 5RWDWHULJKW525RSHUDWLRQVUHXVHWKHELWVZKLFKRYHUVKRRWLQDORJLFDOVKLIWULJKWRSHUDWLRQE\UHLQWURGXFLQJ WKHPDWWKHKLJKHQGRIWKHUHVXOWLQSODFHRIWKH]HURVXVHGWRILOOWKHKLJKHQGLQORJLFDOULJKWRSHUDWLRQV)RU H[DPSOH525LVVKRZQLQ)LJXUH7KHIRUPRIWKHVKLIWILHOGZKLFKPLJKWEHH[SHFWHGWRJLYH525LV &RQWHQWVRI5P FDUU\RXW 9DOXHRIRSHUDQG )LJXUH5RWDWH5LJKW XVHGWRHQFRGHDVSHFLDOIXQFWLRQRIWKHEDUUHOVKLIWHUURWDWHULJKWH[WHQGHG55;7KLVLVDURWDWHULJKWE\RQHELW SRVLWLRQRIWKHELWTXDQWLW\IRUPHGE\DSSHQGLQJWKH&365&IODJWRWKHPRVWVLJQLILFDQWHQGRIWKHFRQWHQWVRI 5PDVVKRZQLQ)LJXUH &RQWHQWVRI5P & LQ 9DOXHRIRSHUDQG FDUU\RXW )LJXUH5RWDWH5LJKW([WHQGHG .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 5HJLVWHUVSHFLILHGVKLIWDPRXQW 2QO\WKHOHDVWVLJQLILFDQWE\WHRIWKHFRQWHQWVRI5VLVXVHGWRGHWHUPLQHWKHVKLIWDPRXQW5VFDQEHDQ\JHQHUDO UHJLVWHURWKHUWKDQ5 ,IWKLVE\WHLV]HURWKHXQFKDQJHGFRQWHQWVRI5PZLOOEHXVHGDVWKHVHFRQGRSHUDQGDQGWKHROGYDOXHRIWKH &365&IODJZLOOEHSDVVHGRQDVWKHVKLIWHUFDUU\RXWSXW ,IWKHE\WHKDVDYDOXHEHWZHHQDQGWKHVKLIWHGUHVXOWZLOOH[DFWO\PDWFKWKDWRIDQLQVWUXFWLRQVSHFLILHGVKLIW ZLWKWKHVDPHYDOXHDQGVKLIWRSHUDWLRQ ,IWKHYDOXHLQWKHE\WHLVRUPRUHWKHUHVXOWZLOOEHDORJLFDOH[WHQVLRQRIWKHVKLIWGHVFULEHGDERYH /6/E\KDVUHVXOW]HURFDUU\RXWHTXDOWRELWRI5P /6/E\PRUHWKDQKDVUHVXOW]HURFDUU\RXW]HUR /65E\KDVUHVXOW]HURFDUU\RXWHTXDOWRELWRI5P /65E\PRUHWKDQKDVUHVXOW]HURFDUU\RXW]HUR $65E\RUPRUHKDVUHVXOWILOOHGZLWKDQGFDUU\RXWHTXDOWRELWRI5P 525E\KDVUHVXOWHTXDOWR5PFDUU\RXWHTXDOWRELWRI5P 525E\QZKHUHQLVJUHDWHUWKDQZLOOJLYHWKHVDPHUHVXOWDQGFDUU\RXWDV525E\QWKHUHIRUH UHSHDWHGO\VXEWUDFWIURPQXQWLOWKHDPRXQWLVLQWKHUDQJHWRDQGVHHDERYH 127( 7KH]HURLQELWRIDQLQVWUXFWLRQZLWKDUHJLVWHUFRQWUROOHGVKLIWLVFRPSXOVRU\DRQHLQWKLVELWZLOOFDXVH WKHLQVWUXFWLRQWREHDPXOWLSO\RUXQGHILQHGLQVWUXFWLRQ $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,00(',$7(23(5$1'527$7(6 7KHLPPHGLDWHRSHUDQGURWDWHILHOGLVDELWXQVLJQHGLQWHJHUZKLFKVSHFLILHVDVKLIWRSHUDWLRQRQWKHELW LPPHGLDWHYDOXH7KLVYDOXHLV]HURH[WHQGHGWRELWVDQGWKHQVXEMHFWWRDURWDWHULJKWE\WZLFHWKHYDOXHLQWKH URWDWHILHOG7KLVHQDEOHVPDQ\FRPPRQFRQVWDQWVWREHJHQHUDWHGIRUH[DPSOHDOOSRZHUVRI :5,7,1*725 :KHQ5GLVDUHJLVWHURWKHUWKDQ5WKHFRQGLWLRQFRGHIODJVLQWKH&365PD\EHXSGDWHGIURPWKH$/8IODJVDV GHVFULEHGDERYH :KHQ5GLV5DQGWKH6IODJLQWKHLQVWUXFWLRQLVQRWVHWWKHUHVXOWRIWKHRSHUDWLRQLVSODFHGLQ5DQGWKH&365 LVXQDIIHFWHG :KHQ5GLV5DQGWKH6IODJLVVHWWKHUHVXOWRIWKHRSHUDWLRQLVSODFHGLQ5DQGWKH6365FRUUHVSRQGLQJWR WKHFXUUHQWPRGHLVPRYHGWRWKH&3657KLVDOORZVVWDWHFKDQJHVZKLFKDWRPLFDOO\UHVWRUHERWK3&DQG&365 7KLVIRUPRILQVWUXFWLRQVKRXOGQRWEHXVHGLQ8VHUPRGH 86,1*5$6$123(5$1' ,I5WKH3&LVXVHGDVDQRSHUDQGLQDGDWDSURFHVVLQJLQVWUXFWLRQWKHUHJLVWHULVXVHGGLUHFWO\ 7KH3&YDOXHZLOOEHWKHDGGUHVVRIWKHLQVWUXFWLRQSOXVRUE\WHVGXHWRLQVWUXFWLRQSUHIHWFKLQJ,IWKHVKLIW DPRXQWLVVSHFLILHGLQWKHLQVWUXFWLRQWKH3&ZLOOEHE\WHVDKHDG,IDUHJLVWHULVXVHGWRVSHFLI\WKHVKLIWDPRXQW WKH3&ZLOOEHE\WHVDKHDG 7(4767&03$1'&0123&2'(6 127( 7(4767&03DQG&01GRQRWZULWHWKHUHVXOWRIWKHLURSHUDWLRQEXWGRVHWIODJVLQWKH&365$Q DVVHPEOHUVKRXOGDOZD\VVHWWKH6IODJIRUWKHVHLQVWUXFWLRQVHYHQLIWKLVLVQRWVSHFLILHGLQWKHPQHPRQLF 7KH7(43IRUPRIWKH7(4LQVWUXFWLRQXVHGLQHDUOLHU$50SURFHVVRUVPXVWQRWEHXVHGWKH365WUDQVIHU RSHUDWLRQVVKRXOGEHXVHGLQVWHDG 7KHDFWLRQRI7(43LQWKH$507'0,LVWRPRYH6365BPRGH!WRWKH&365LIWKHSURFHVVRULVLQD SULYLOHJHGPRGHDQGWRGRQRWKLQJLILQ8VHUPRGH ,16758&7,21&<&/(7,0(6 'DWD3URFHVVLQJLQVWUXFWLRQVYDU\LQWKHQXPEHURILQFUHPHQWDOF\FOHVWDNHQDVIROORZV 7DEOH,QFUHPHQWDO&\FOH7LPHV 3URFHVVLQJ7\SH 1RUPDO'DWD3URFHVVLQJ 'DWD3URFHVVLQJZLWKUHJLVWHUVSHFLILHGVKLIW 'DWD3URFHVVLQJZLWK3&ZULWWHQ 'DWD3URFHVVLQJZLWKUHJLVWHUVSHFLILHGVKLIWDQG3& ZULWWHQ 6 6, 61 61, &\FOHV 127( 61DQG,DUHDVGHILQHGVHTXHQWLDO6F\FOHQRQVHTXHQFLDO1F\FOHDQGLQWHUQDO,F\FOHUHVSHFWLYHO\ .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 $66(0%/(56<17$; 029091VLQJOHRSHUDQGLQVWUXFWLRQV RSFRGH!^FRQG`^6`5G2S! &03&017(4767LQVWUXFWLRQVZKLFKGRQRWSURGXFHDUHVXOW RSFRGH!^FRQG`5Q2S! $1'(2568%56%$''$'&6%&56&255%,& RSFRGH!^FRQG`^6`5G5Q2S! ZKHUH 2S! ^FRQG` ^6` 5G5QDQG5P H[SUHVVLRQ! VKLIW! VKLIWQDPH!V 5P^VKLIW!`RUH[SUHVVLRQ! $WZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH 6HWFRQGLWLRQFRGHVLI6SUHVHQWLPSOLHGIRU&03&017(4767 ([SUHVVLRQVHYDOXDWLQJWRDUHJLVWHUQXPEHU ,IWKLVLVXVHGWKHDVVHPEOHUZLOODWWHPSWWRJHQHUDWHDVKLIWHGLPPHGLDWHELWILHOGWR PDWFKWKHH[SUHVVLRQ,IWKLVLVLPSRVVLEOHLWZLOOJLYHDQHUURU 6KLIWQDPH!UHJLVWHU!RUVKLIWQDPH!H[SUHVVLRQRU55;URWDWHULJKWRQHELWZLWK H[WHQG $6//6//65$65525$6/LVDV\QRQ\PIRU/6/WKH\DVVHPEOHWRWKHVDPH FRGH (;$03/(6 $''(4 7(46 555 5 ,IWKH=IODJLVVHWPDNH5 55 7HVW5IRUHTXDOLW\ZLWK 7KH6LVLQIDFWUHGXQGDQWDVWKH DVVHPEOHULQVHUWVLWDXWRPDWLFDOO\ /RJLFDOULJKWVKLIW5E\WKHQXPEHULQ WKHERWWRPE\WHRI5VXEWUDFWUHVXOW IURP5DQGSXWWKHDQVZHULQWR5 5HWXUQIURPVXEURXWLQH 5HWXUQIURPH[FHSWLRQDQGUHVWRUH&365 IURP6365BPRGH 68% 555/655 029 0296 3&5 3&5 $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 36575$16)(5056065 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH 7KH056DQG065LQVWUXFWLRQVDUHIRUPHGIURPDVXEVHWRIWKH'DWD3URFHVVLQJRSHUDWLRQVDQGDUHLPSOHPHQWHG XVLQJWKH7(4767&01DQG&03LQVWUXFWLRQVZLWKRXWWKH6IODJVHW7KHHQFRGLQJLVVKRZQLQ)LJXUH 7KHVHLQVWUXFWLRQVDOORZDFFHVVWRWKH&365DQG6365UHJLVWHUV7KH056LQVWUXFWLRQDOORZVWKHFRQWHQWVRIWKH &365RU6365BPRGH!WREHPRYHGWRDJHQHUDOUHJLVWHU7KH065LQVWUXFWLRQDOORZVWKHFRQWHQWVRIDJHQHUDO UHJLVWHUWREHPRYHGWRWKH&365RU6365BPRGH!UHJLVWHU 7KH065LQVWUXFWLRQDOVRDOORZVDQLPPHGLDWHYDOXHRUUHJLVWHUFRQWHQWVWREHWUDQVIHUUHGWRWKHFRQGLWLRQFRGH IODJV1=&DQG9RI&365RU6365BPRGH!ZLWKRXWDIIHFWLQJWKHFRQWUROELWV,QWKLVFDVHWKHWRSIRXUELWVRI WKHVSHFLILHGUHJLVWHUFRQWHQWVRUELWLPPHGLDWHYDOXHDUHZULWWHQWRWKHWRSIRXUELWVRIWKHUHOHYDQW365 23(5$1'5(675,&7,216 ,QXVHUPRGHWKHFRQWUROELWVRIWKH&365DUHSURWHFWHGIURPFKDQJHVRRQO\WKHFRQGLWLRQFRGHIODJVRIWKH &365FDQEHFKDQJHG,QRWKHUSULYLOHJHGPRGHVWKHHQWLUH&365FDQEHFKDQJHG 1RWHWKDWWKHVRIWZDUHPXVWQHYHUFKDQJHWKHVWDWHRIWKH7ELWLQWKH&365,IWKLVKDSSHQVWKHSURFHVVRUZLOO HQWHUDQXQSUHGLFWDEOHVWDWH 7KH6365UHJLVWHUZKLFKLVDFFHVVHGGHSHQGVRQWKHPRGHDWWKHWLPHRIH[HFXWLRQ)RUH[DPSOHRQO\ 6365BILTLVDFFHVVLEOHZKHQWKHSURFHVVRULVLQ),4PRGH <RXPXVWQRWVSHFLI\5DVWKHVRXUFHRUGHVWLQDWLRQUHJLVWHU $OVRGRQRWDWWHPSWWRDFFHVVDQ6365LQ8VHUPRGHVLQFHQRVXFKUHJLVWHUH[LVWV .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 056WUDQVIHU365FRQWHQWVWRDUHJLVWHU &RQG 3V 5G >@'HVWLQDWLRQUHJLVWHU &365 >@6RXUFH365 6365BFXUUHQWPRGH! >@&RQGLWLRQILHOG 056WUDQVIHUUHJLVWHUFRQWHQWVWR365 &RQG 3G >@6RXUFHUHJLVWHU >@'HVWLQDWLRQ365 &365 5P 6365BFXUUHQWPRGH! >@&RQGLWLRQILHOG 056WUDQVIHUUHJLVWHUFRQWHQWVRULPPGLDWHYDOXHWR365IODJELWVRQO\ &RQG , 3G &365 6RXUFHRSHUDQG >@'HVWLQDWLRQ365 6365BFXUUHQWPRGH! >@,PPHGLDWH2SHUDQG 6RXUFHRSHUDQGLVDUHJLVWHU 6365BFXUUHQWPRGH! >@6RXUFHRSHUDQG 5P >@6RXUFHUHJLVWHU >@6RXUFHRSHUDQGLVDQLPPHGLDWHYDOXH 5RWDWH ,PP >@8QVLJQHGELWLPPHGLDWHYDOXH >@6KLIWDSSOLHGWROPP >@&RQGLWLRQILHOG )LJXUH3657UDQVIHU $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 5(6(59('%,76 2QO\WZHOYHELWVRIWKH365DUHGHILQHGLQ$507'0,1=&9,)70>@WKHUHPDLQLQJELWVDUHUHVHUYHGIRU XVHLQIXWXUHYHUVLRQVRIWKHSURFHVVRU5HIHUWR)LJXUHIRUDIXOOGHVFULSWLRQRIWKH365ELWV 7RHQVXUHWKHPD[LPXPFRPSDWLELOLW\EHWZHHQ$507'0,SURJUDPVDQGIXWXUHSURFHVVRUVWKHIROORZLQJUXOHV VKRXOGEHREVHUYHG 7KHUHVHUYHGELWVVKRXOGEHSUHVHUYHGZKHQFKDQJLQJWKHYDOXHLQD365 3URJUDPVVKRXOGQRWUHO\RQVSHFLILFYDOXHVIURPWKHUHVHUYHGELWVZKHQFKHFNLQJWKH365VWDWXVVLQFHWKH\ PD\UHDGDVRQHRU]HURLQIXWXUHSURFHVVRUV $UHDGPRGLI\ZULWHVWUDWHJ\VKRXOGWKHUHIRUHEHXVHGZKHQDOWHULQJWKHFRQWUROELWVRIDQ\365UHJLVWHUWKLV LQYROYHVWUDQVIHUULQJWKHDSSURSULDWH365UHJLVWHUWRDJHQHUDOUHJLVWHUXVLQJWKH056LQVWUXFWLRQFKDQJLQJRQO\ WKHUHOHYDQWELWVDQGWKHQWUDQVIHUULQJWKHPRGLILHGYDOXHEDFNWRWKH365UHJLVWHUXVLQJWKH065LQVWUXFWLRQ (;$03/(6 7KHIROORZLQJVHTXHQFHSHUIRUPVDPRGHFKDQJH 056 %,& 255 065 5&365 55[) 55QHZBPRGH &3655 7DNHDFRS\RIWKH&365 &OHDUWKHPRGHELWV 6HOHFWQHZPRGH :ULWHEDFNWKHPRGLILHG&365 :KHQWKHDLPLVVLPSO\WRFKDQJHWKHFRQGLWLRQFRGHIODJVLQD365DYDOXHFDQEHZULWWHQGLUHFWO\WRWKHIODJELWV ZLWKRXWGLVWXUELQJWKHFRQWUROELWV7KHIROORZLQJLQVWUXFWLRQVHWVWKH1=&DQG9IODJV 065 &365BIOJ[) 6HWDOOWKHIODJVHJDUGOHVVRIWKHLUSUHYLRXVVWDWH GRHVQRWDIIHFWDQ\FRQWUROELWV 1RDWWHPSWVKRXOGEHPDGHWRZULWHDQELWLPPHGLDWHYDOXHLQWRWKHZKROH365VLQFHVXFKDQRSHUDWLRQFDQQRW SUHVHUYHWKHUHVHUYHGELWV ,16758&7,21&<&/(7,0(6 365WUDQVIHUVWDNH6LQFUHPHQWDOF\FOHVZKHUH6LVGHILQHGDV6HTXHQWLDO6F\FOH .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 $66(0%/(56<17$; 056WUDQVIHU365FRQWHQWVWRDUHJLVWHU 056^FRQG`5GSVU! 065WUDQVIHUUHJLVWHUFRQWHQWVWR365 065^FRQG`SVU!5P 065WUDQVIHUUHJLVWHUFRQWHQWVWR365IODJELWVRQO\ 065^FRQG`SVUI!5P 7KHPRVWVLJQLILFDQWIRXUELWVRIWKHUHJLVWHUFRQWHQWVDUHZULWWHQWRWKH1=&9IODJVUHVSHFWLYHO\ 065WUDQVIHULPPHGLDWHYDOXHWR365IODJELWVRQO\ 065^FRQG`SVUI!H[SUHVVLRQ! 7KHH[SUHVVLRQVKRXOGV\PEROLVHDELWYDOXHRIZKLFKWKHPRVWVLJQLILFDQWIRXUELWVDUHZULWWHQWRWKH1=&DQG 9IODJVUHVSHFWLYHO\ .H\ ^FRQG` 5GDQG5P SVU! SVUI! H[SUHVVLRQ! (;$03/(6 ,Q8VHUPRGHWKHLQVWUXFWLRQVEHKDYHDVIROORZV 065 065 065 056 &365BDOO5P &365BIOJ5P &365BIOJ[$ 5G&365 &365>@5P>@ &365>@5P>@ &365>@[$VHW1&FOHDU=9 5G>@&365>@ 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH ([SUHVVLRQVHYDOXDWLQJWRDUHJLVWHUQXPEHURWKHUWKDQ5 &365&365BDOO6365RU6365BDOO&365DQG&365BDOODUHV\QRQ\PVDVDUH 6365DQG6365BDOO &365BIOJRU6365BIOJ :KHUHWKLVLVXVHGWKHDVVHPEOHUZLOODWWHPSWWRJHQHUDWHDVKLIWHGLPPHGLDWHELW ILHOGWRPDWFKWKHH[SUHVVLRQ,IWKLVLVLPSRVVLEOHLWZLOOJLYHDQHUURU ,QSULYLOHJHGPRGHVWKHLQVWUXFWLRQVEHKDYHDVIROORZV 065 065 065 065 065 065 056 &365BDOO5P &365BIOJ5P &365BIOJ[ 6365BDOO5P 6365BIOJ5P 6365BIOJ[& 5G6365 &365>@5P>@ &365>@5P>@ &365>@[VHW=9FOHDU1& 6365BPRGH!>@5P>@ 6365BPRGH!>@5P>@ 6365BPRGH!>@[&VHW1=FOHDU&9 5G>@6365BPRGH!>@ $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 08/7,3/<$1'08/7,3/<$&&808/$7(08/0/$ 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH 7KHPXOWLSO\DQGPXOWLSO\DFFXPXODWHLQVWUXFWLRQVXVHDQELW%RRWKVDOJRULWKPWRSHUIRUPLQWHJHUPXOWLSOLFDWLRQ &RQG $ 6 5G 5Q 5V 5P >@>@>@2SHUDQGUHJLVWHUV >@'HVWLQDWLRQUHJLVWHU >@6HWFRQGLWLRQVHW GRQRWDOWHUFRQGLWLRQFRGHV VHWFRQGLWLRQFRGHV >@$FFXPXODWH PXOWLSO\RQO\ PXOWLSO\DQGDFFXPXODWH >@&RQGLWLRQ)LHOG )LJXUH0XOWLSO\,QVWUXFWLRQV 7KHPXOWLSO\IRUPRIWKHLQVWUXFWLRQJLYHV5G 5P5V5QLVLJQRUHGDQGVKRXOGEHVHWWR]HURIRUFRPSDWLELOLW\ZLWK SRVVLEOHIXWXUHXSJUDGHVWRWKHLQVWUXFWLRQVHW7KHPXOWLSO\DFFXPXODWHIRUPJLYHV5G 5P5V5QZKLFKFDQ VDYHDQH[SOLFLW$''LQVWUXFWLRQLQVRPHFLUFXPVWDQFHV%RWKIRUPVRIWKHLQVWUXFWLRQZRUNRQRSHUDQGVZKLFKPD\ EHFRQVLGHUHGDVVLJQHGVFRPSOHPHQWRUXQVLJQHGLQWHJHUV 7KHUHVXOWVRIDVLJQHGPXOWLSO\DQGRIDQXQVLJQHGPXOWLSO\RIELWRSHUDQGVGLIIHURQO\LQWKHXSSHUELWVWKH ORZELWVRIWKHVLJQHGDQGXQVLJQHGUHVXOWVDUHLGHQWLFDO$VWKHVHLQVWUXFWLRQVRQO\SURGXFHWKHORZELWVRID PXOWLSO\WKH\FDQEHXVHGIRUERWKVLJQHGDQGXQVLJQHGPXOWLSOLHV )RUH[DPSOHFRQVLGHUWKHPXOWLSOLFDWLRQRIWKHRSHUDQGV 2SHUDQG$ 2SHUDQG% 5HVXOW [))))))) [ [)))))) ,IWKH2SHUDQGV$UH,QWHUSUHWHGDV6LJQHG 2SHUDQG$KDVWKHYDOXHRSHUDQG%KDVWKHYDOXHDQGWKHUHVXOWLVZKLFKLVFRUUHFWO\UHSUHVHQWHGDV [)))))) ,IWKH2SHUDQGV$UH,QWHUSUHWHGDV8QVLJQHG 2SHUDQG$KDVWKHYDOXHRSHUDQG%KDVWKHYDOXHDQGWKHUHVXOWLVZKLFKLV UHSUHVHQWHGDV[))))))VRWKHOHDVWVLJQLILFDQWELWVDUH[)))))) 2SHUDQG5HVWULFWLRQV 7KHGHVWLQDWLRQUHJLVWHU5GPXVWQRWEHWKHVDPHDVWKHRSHUDQGUHJLVWHU5P5PXVWQRWEHXVHGDVDQRSHUDQG RUDVWKHGHVWLQDWLRQUHJLVWHU $OORWKHUUHJLVWHUFRPELQDWLRQVZLOOJLYHFRUUHFWUHVXOWVDQG5G5QDQG5VPD\XVHWKHVDPHUHJLVWHUZKHQUHTXLUHG .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 &365)/$*6 6HWWLQJWKH&365IODJVLVRSWLRQDODQGLVFRQWUROOHGE\WKH6ELWLQWKHLQVWUXFWLRQ7KH11HJDWLYHDQG==HUR IODJVDUHVHWFRUUHFWO\RQWKHUHVXOW1LVPDGHHTXDOWRELWRIWKHUHVXOWDQG=LVVHWLIDQGRQO\LIWKHUHVXOWLV ]HUR7KH&&DUU\IODJLVVHWWRDPHDQLQJOHVVYDOXHDQGWKH9R9HUIORZIODJLVXQDIIHFWHG ,16758&7,21&<&/(7,0(6 08/WDNHV6P,DQG0/$6P,F\FOHVWRH[HFXWHZKHUH6DQG,DUHGHILQHGDVVHTXHQWLDO6F\FOHDQG LQWHUQDO,F\FOHUHVSHFWLYHO\ P 7KHQXPEHURIELWPXOWLSOLHUDUUD\F\FOHVLVUHTXLUHGWRFRPSOHWHWKHPXOWLSO\ZKLFKLV FRQWUROOHGE\WKHYDOXHRIWKHPXOWLSOLHURSHUDQGVSHFLILHGE\5V,WVSRVVLEOHYDOXHVDUH DVIROORZV ,IELWV>@RIWKHPXOWLSOLHURSHUDQGDUHDOO]HURRUDOORQH ,IELWV>@RIWKHPXOWLSOLHURSHUDQGDUHDOO]HURRUDOORQH ,IELWV>@RIWKHPXOWLSOLHURSHUDQGDUHDOO]HURRUDOORQH ,QDOORWKHUFDVHV $66(0%/(56<17$; 08/^FRQG`^6`5G5P5V 0/$^FRQG`^6`5G5P5V5Q ^FRQG` ^6` 5G5P5VDQG5Q (;$03/(6 08/ 0/$(46 555 5555 5 55 &RQGLWLRQDOO\5 5556HWWLQJFRQGLWLRQFRGHV 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH 6HWFRQGLWLRQFRGHVLI6SUHVHQW ([SUHVVLRQVHYDOXDWLQJWRDUHJLVWHUQXPEHURWKHUWKDQ5 $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 08/7,3/</21*$1'08/7,3/<$&&808/$7(/21*08//0/$/ 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH 7KHPXOWLSO\ORQJLQVWUXFWLRQVSHUIRUPLQWHJHUPXOWLSOLFDWLRQRQWZRELWRSHUDQGVDQGSURGXFHELWUHVXOWV 6LJQHGDQGXQVLJQHGPXOWLSOLFDWLRQHDFKZLWKRSWLRQDODFFXPXODWHJLYHULVHWRIRXUYDULDWLRQV &RQG 8 $ 6 5G+L 5G/R 5V 5P >@>@2SHUDQGUHJLVWHUV >@>@6RXUFHGHVWLQDWLRQUHJLVWHUV >@6HWFRQGLWLRQFRGH GRQRWDOWHUFRQGLWLRQFRGHV VHWFRQGLWLRQFRGHV >@$FFXPXODWH PXOWLSO\RQO\ PXOWLSO\DQGDFFXPXODWH >@8QVLJQHG XQVLJQHG VLJQHG >@&RQGLWLRQ)LHOG )LJXUH0XOWLSO\/RQJ,QVWUXFWLRQV 7KHPXOWLSO\IRUPV808//DQG608//WDNHWZRELWQXPEHUVDQGPXOWLSO\WKHPWRSURGXFHDELWUHVXOWRIWKH IRUP5G+L5G/R 5P5V7KHORZHUELWVRIWKHELWUHVXOWDUHZULWWHQWR5G/RWKHXSSHUELWVRIWKHUHVXOW DUHZULWWHQWR5G+L 7KHPXOWLSO\DFFXPXODWHIRUPV80/$/DQG60/$/WDNHWZRELWQXPEHUVPXOWLSO\WKHPDQGDGGDELW QXPEHUWRSURGXFHDELWUHVXOWRIWKHIRUP5G+L5G/R 5P5V5G+L5G/R7KHORZHUELWVRIWKHELW QXPEHUWRDGGLVUHDGIURP5G/R7KHXSSHUELWVRIWKHELWQXPEHUWRDGGLVUHDGIURP5G+L7KHORZHU ELWVRIWKHELWUHVXOWDUHZULWWHQWR5G/R7KHXSSHUELWVRIWKHELWUHVXOWDUHZULWWHQWR5G+L 7KH808//DQG80/$/LQVWUXFWLRQVWUHDWDOORIWKHLURSHUDQGVDVXQVLJQHGELQDU\QXPEHUVDQGZULWHDQXQVLJQHG ELWUHVXOW7KH608//DQG60/$/LQVWUXFWLRQVWUHDWDOORIWKHLURSHUDQGVDVWZRVFRPSOHPHQWVLJQHGQXPEHUV DQGZULWHDWZRVFRPSOHPHQWVLJQHGELWUHVXOW 23(5$1'5(675,&7,216 5PXVWQRWEHXVHGDVDQRSHUDQGRUDVDGHVWLQDWLRQUHJLVWHU 5G+L5G/RDQG5PPXVWDOOVSHFLI\GLIIHUHQWUHJLVWHUV &365)/$*6 6HWWLQJWKH&365IODJVLVRSWLRQDODQGLVFRQWUROOHGE\WKH6ELWLQWKHLQVWUXFWLRQ7KH1DQG=IODJVDUHVHW FRUUHFWO\RQWKHUHVXOW1LVHTXDOWRELWRIWKHUHVXOW=LVVHWLIDQGRQO\LIDOOELWVRIWKHUHVXOWDUH]HUR%RWK WKH&DQG9IODJVDUHVHWWRPHDQLQJOHVVYDOXHV .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 ,16758&7,21&<&/(7,0(6 08//WDNHV6P,DQG0/$/6P,F\FOHVWRH[HFXWHZKHUHPLVWKHQXPEHURIELWPXOWLSOLHUDUUD\ F\FOHVUHTXLUHGWRFRPSOHWHWKHPXOWLSO\ZKLFKLVFRQWUROOHGE\WKHYDOXHRIWKHPXOWLSOLHURSHUDQGVSHFLILHGE\5V ,WVSRVVLEOHYDOXHVDUHDVIROORZV )RU6LJQHG,QVWUXFWLRQV608//60/$/ ,IELWV>@RIWKHPXOWLSOLHURSHUDQGDUHDOO]HURRUDOORQH ,IELWV>@RIWKHPXOWLSOLHURSHUDQGDUHDOO]HURRUDOORQH ,IELWV>@RIWKHPXOWLSOLHURSHUDQGDUHDOO]HURRUDOORQH ,QDOORWKHUFDVHV )RU8QVLJQHG,QVWUXFWLRQV808//80/$/ ,IELWV>@RIWKHPXOWLSOLHURSHUDQGDUHDOO]HUR ,IELWV>@RIWKHPXOWLSOLHURSHUDQGDUHDOO]HUR ,IELWV>@RIWKHPXOWLSOLHURSHUDQGDUHDOO]HUR ,QDOORWKHUFDVHV 6DQG,DUHGHILQHGDVVHTXHQWLDO6F\FOHDQGLQWHUQDO,F\FOHUHVSHFWLYHO\ $66(0%/(56<17$; 7DEOH$VVHPEOHU6\QWD['HVFULSWLRQV 0QHPRQLF 808//^FRQG`^6`5G/R5G+L5P5V 80/$/^FRQG`^6`5G/R5G+L5P5V 608//^FRQG`^6`5G/R5G+L5P5V 60/$/^FRQG`^6`5G/R5G+L5P5V ZKHUH ^FRQG` ^6` 5G/R5G+L5P5V (;$03/(6 808// 80/$/6 5555 5555 55 55 55 5555DOVRVHWWLQJFRQGLWLRQFRGHV 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH 6HWFRQGLWLRQFRGHVLI6SUHVHQW ([SUHVVLRQVHYDOXDWLQJWRDUHJLVWHUQXPEHURWKHUWKDQ5 'HVFULSWLRQ 8QVLJQHG0XOWLSO\/RQJ 8QVLJQHG0XOWLSO\$FFXPXODWH/RQJ 6LJQHG0XOWLSO\/RQJ 6LJQHG0XOWLSO\$FFXPXODWH/RQJ 3XUSRVH [ [ [ [ $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 6,1*/('$7$75$16)(5/'5675 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH 7KHVLQJOHGDWDWUDQVIHULQVWUXFWLRQVDUHXVHGWRORDGRUVWRUHVLQJOHE\WHVRUZRUGVRIGDWD7KHPHPRU\DGGUHVV XVHGLQWKHWUDQVIHULVFDOFXODWHGE\DGGLQJDQRIIVHWWRRUVXEWUDFWLQJDQRIIVHWIURPDEDVHUHJLVWHU 7KHUHVXOWRIWKLVFDOFXODWLRQPD\EHZULWWHQEDFNLQWRWKHEDVHUHJLVWHULIDXWRLQGH[LQJLVUHTXLUHG &RQG , 3 8 % : / 5Q 5G 2IIVHW >@6RXUFH'HVWLQDWLRQUHJLVWHU >@%DVHUHJLVWHU 6WRUHWRPHPRU\ /RDGIURPPHPRU\ >@/RDG6WRUHELW >@:ULWHEDFNELW 1RZULWHEDFN :ULWHDGGUHVVLQWREDVH >@%\WH:RUGELW 7UDQVIHUZRUGTXDQWLW\ 7UDQVIHUE\WHTXDQWLW\ >@8S'RZQELW 'RZQVXEWUDFWRIIVHWIURPEDVH 8SDGGRIIVHWWREDVH >@3UH3RVWLQGH[LQJELW 3RVWDGGRIIVHWDIWHUWUDQVIHU 3UHDGGRIIVHWEHIRUHWUDQVIHU >@,PPHGLDWHRIIVHW >@2IIVHW 2IIVHWLVDQLPPHGLDWHYDOXH ,PPHGLDWHRIIVHW >@8QVLJQHGELWLPPHGLDWHRIIVHW 6KLIW 5P >@2IIVHWUHJLVWHU >@6KLIWDSSOLHGWR5P >@&RQGLWLRQILHOG )LJXUH6LQJOH'DWD7UDQVIHU,QVWUXFWLRQV .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 2))6(76$1'$872,1'(;,1* 7KHRIIVHWIURPWKHEDVHPD\EHHLWKHUDELWXQVLJQHGELQDU\LPPHGLDWHYDOXHLQWKHLQVWUXFWLRQRUDVHFRQG UHJLVWHUSRVVLEO\VKLIWHGLQVRPHZD\7KHRIIVHWPD\EHDGGHGWR8 RUVXEWUDFWHGIURP8 WKHEDVH UHJLVWHU5Q7KHRIIVHWPRGLILFDWLRQPD\EHSHUIRUPHGHLWKHUEHIRUHSUHLQGH[HG3 RUDIWHUSRVWLQGH[HG3 WKHEDVHLVXVHGDVWKHWUDQVIHUDGGUHVV 7KH:ELWJLYHVRSWLRQDODXWRLQFUHPHQWDQGGHFUHPHQWDGGUHVVLQJPRGHV7KHPRGLILHGEDVHYDOXHPD\EH ZULWWHQEDFNLQWRWKHEDVH: RUWKHROGEDVHYDOXHPD\EHNHSW: ,QWKHFDVHRISRVWLQGH[HGDGGUHVVLQJ WKHZULWHEDFNELWLVUHGXQGDQWDQGLVDOZD\VVHWWR]HURVLQFHWKHROGEDVHYDOXHFDQEHUHWDLQHGE\VHWWLQJWKH RIIVHWWR]HUR7KHUHIRUHSRVWLQGH[HGGDWDWUDQVIHUVDOZD\VZULWHEDFNWKHPRGLILHGEDVH7KHRQO\XVHRIWKH:ELW LQDSRVWLQGH[HGGDWDWUDQVIHULVLQSULYLOHJHGPRGHFRGHZKHUHVHWWLQJWKH:ELWIRUFHVQRQSULYLOHJHGPRGHIRU WKHWUDQVIHUDOORZLQJWKHRSHUDWLQJV\VWHPWRJHQHUDWHDXVHUDGGUHVVLQDV\VWHPZKHUHWKHPHPRU\PDQDJHPHQW KDUGZDUHPDNHVVXLWDEOHXVHRIWKLVKDUGZDUH 6+,)7('5(*,67(52))6(7 7KHVKLIWFRQWUROELWVDUHGHVFULEHGLQWKHGDWDSURFHVVLQJLQVWUXFWLRQVVHFWLRQ+RZHYHUWKHUHJLVWHUVSHFLILHG VKLIWDPRXQWVDUHQRWDYDLODEOHLQWKLVLQVWUXFWLRQFODVV6HH)LJXUH %<7(6$1':25'6 7KLVLQVWUXFWLRQFODVVPD\EHXVHGWRWUDQVIHUDE\WH% RUDZRUG% EHWZHHQDQ$507'0,UHJLVWHUDQG PHPRU\ 7KHDFWLRQRI/'5%DQG675%LQVWUXFWLRQVLVLQIOXHQFHGE\WKH%,*(1'FRQWUROVLJQDORI$507'0,FRUH7KH WZRSRVVLEOHFRQILJXUDWLRQVDUHGHVFULEHGEHORZ /LWWOH(QGLDQ&RQILJXUDWLRQ $E\WHORDG/'5%H[SHFWVWKHGDWDRQGDWDEXVLQSXWVWKURXJKLIWKHVXSSOLHGDGGUHVVLVRQDZRUGERXQGDU\ RQGDWDEXVLQSXWVWKURXJKLILWLVDZRUGDGGUHVVSOXVRQHE\WHDQGVRRQ7KHVHOHFWHGE\WHLVSODFHGLQWKH ERWWRPELWVRIWKHGHVWLQDWLRQUHJLVWHUDQGWKHUHPDLQLQJELWVRIWKHUHJLVWHUDUHILOOHGZLWK]HURV3OHDVHVHH )LJXUH $E\WHVWRUH675%UHSHDWVWKHERWWRPELWVRIWKHVRXUFHUHJLVWHUIRXUWLPHVDFURVVGDWDEXVRXWSXWVWKURXJK 7KHH[WHUQDOPHPRU\V\VWHPVKRXOGDFWLYDWHWKHDSSURSULDWHE\WHVXEV\VWHPWRVWRUHWKHGDWD $ZRUGORDG/'5ZLOOQRUPDOO\XVHDZRUGDOLJQHGDGGUHVV+RZHYHUDQDGGUHVVRIIVHWIURPDZRUGERXQGDU\ZLOO FDXVHWKHGDWDWREHURWDWHGLQWRWKHUHJLVWHUVRWKDWWKHDGGUHVVHGE\WHRFFXSLHVELWVWR7KLVPHDQVWKDWKDOI ZRUGVDFFHVVHGDWRIIVHWVDQGIURPWKHZRUGERXQGDU\ZLOOEHFRUUHFWO\ORDGHGLQWRELWVWKURXJKRIWKH UHJLVWHU7ZRVKLIWRSHUDWLRQVDUHWKHQUHTXLUHGWRFOHDURUWRVLJQH[WHQGWKHXSSHUELWV $ZRUGVWRUH675VKRXOGJHQHUDWHDZRUGDOLJQHGDGGUHVV7KHZRUGSUHVHQWHGWRWKHGDWDEXVLVQRWDIIHFWHGLI WKHDGGUHVVLVQRWZRUGDOLJQHG7KDWLVELWRIWKHUHJLVWHUEHLQJVWRUHGDOZD\VDSSHDUVRQGDWDEXVRXWSXW $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 PHPRU\ $ $ $ $ $ % & ' UHJLVWHU $ % & ' /'5IURPZRUGDOLJQHGDGGUHVV $ $ $ $ $ % & ' /'5IURPDGGUHVVRIIVHWE\ $ % & ' )LJXUH/LWWOH(QGLDQ2IIVHW$GGUHVVLQJ %LJ(QGLDQ&RQILJXUDWLRQ $E\WHORDG/'5%H[SHFWVWKHGDWDRQGDWDEXVLQSXWVWKURXJKLIWKHVXSSOLHGDGGUHVVLVRQDZRUGERXQGDU\ RQGDWDEXVLQSXWVWKURXJKLILWLVDZRUGDGGUHVVSOXVRQHE\WHDQGVRRQ7KHVHOHFWHGE\WHLVSODFHGLQWKH ERWWRPELWVRIWKHGHVWLQDWLRQUHJLVWHUDQGWKHUHPDLQLQJELWVRIWKHUHJLVWHUDUHILOOHGZLWK]HURV3OHDVHVHH)LJXUH $E\WHVWRUH675%UHSHDWVWKHERWWRPELWVRIWKHVRXUFHUHJLVWHUIRXUWLPHVDFURVVGDWDEXVRXWSXWVWKURXJK 7KHH[WHUQDOPHPRU\V\VWHPVKRXOGDFWLYDWHWKHDSSURSULDWHE\WHVXEV\VWHPWRVWRUHWKHGDWD $ZRUGORDG/'5VKRXOGJHQHUDWHDZRUGDOLJQHGDGGUHVV$QDGGUHVVRIIVHWRIRUIURPDZRUGERXQGDU\ZLOO FDXVHWKHGDWDWREHURWDWHGLQWRWKHUHJLVWHUVRWKDWWKHDGGUHVVHGE\WHRFFXSLHVELWVWKURXJK7KLVPHDQV WKDWKDOIZRUGVDFFHVVHGDWWKHVHRIIVHWVZLOOEHFRUUHFWO\ORDGHGLQWRELWVWKURXJKRIWKHUHJLVWHU$VKLIW RSHUDWLRQLVWKHQUHTXLUHGWRPRYHDQGRSWLRQDOO\VLJQH[WHQGWKHGDWDLQWRWKHERWWRPELWV$QDGGUHVVRIIVHW RIRUIURPDZRUGERXQGDU\ZLOOFDXVHWKHGDWDWREHURWDWHGLQWRWKHUHJLVWHUVRWKDWWKHDGGUHVVHGE\WH RFFXSLHVELWVWKURXJK $ZRUGVWRUH675VKRXOGJHQHUDWHDZRUGDOLJQHGDGGUHVV7KHZRUGSUHVHQWHGWRWKHGDWDEXVLVQRWDIIHFWHGLI WKHDGGUHVVLVQRWZRUGDOLJQHG7KDWLVELWRIWKHUHJLVWHUEHLQJVWRUHGDOZD\VDSSHDUVRQGDWDEXVRXWSXW .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 86(2)5 :ULWHEDFNPXVWQRWEHVSHFLILHGLI5LVVSHFLILHGDVWKHEDVHUHJLVWHU5Q:KHQXVLQJ5DVWKHEDVHUHJLVWHU \RXPXVWUHPHPEHULWFRQWDLQVDQDGGUHVVE\WHVRQIURPWKHDGGUHVVRIWKHFXUUHQWLQVWUXFWLRQ 5PXVWQRWEHVSHFLILHGDVWKHUHJLVWHURIIVHW5P :KHQ5LVWKHVRXUFHUHJLVWHU5GRIDUHJLVWHUVWRUH675LQVWUXFWLRQWKHVWRUHGYDOXHZLOOEHDGGUHVVRIWKH LQVWUXFWLRQSOXV 5(675,&7,21217+(86(2)%$6(5(*,67(5 :KHQFRQILJXUHGIRUODWHDERUWVWKHIROORZLQJH[DPSOHFRGHLVGLIILFXOWWRXQZLQGDVWKHEDVHUHJLVWHU5QJHWV XSGDWHGEHIRUHWKHDERUWKDQGOHUVWDUWV6RPHWLPHVLWPD\EHLPSRVVLEOHWRFDOFXODWHWKHLQLWLDOYDOXH $IWHUDQDERUWWKHIROORZLQJH[DPSOHFRGHLVGLIILFXOWWRXQZLQGDVWKHEDVHUHJLVWHU5QJHWVXSGDWHGEHIRUHWKH DERUWKDQGOHUVWDUWV6RPHWLPHVLWPD\EHLPSRVVLEOHWRFDOFXODWHWKHLQLWLDOYDOXH ([DPSOH /'5 5>[email protected] 7KHUHIRUHDSRVWLQGH[HG/'5RU675ZKHUH5PLVWKHVDPHUHJLVWHUDV5QVKRXOGQRWEHXVHG '$7$$%2576 $WUDQVIHUWRRUIURPDOHJDODGGUHVVPD\FDXVHSUREOHPVIRUDPHPRU\PDQDJHPHQWV\VWHP)RULQVWDQFHLQD V\VWHPZKLFKXVHVYLUWXDOPHPRU\WKHUHTXLUHGGDWDPD\EHDEVHQWIURPPDLQPHPRU\7KHPHPRU\PDQDJHUFDQ VLJQDODSUREOHPE\WDNLQJWKHSURFHVVRU$%257LQSXW+,*+ZKHUHXSRQWKH'DWD$ERUWWUDSZLOOEHWDNHQ,WLVXS WRWKHV\VWHPVRIWZDUHWRUHVROYHWKHFDXVHRIWKHSUREOHPWKHQWKHLQVWUXFWLRQFDQEHUHVWDUWHGDQGWKHRULJLQDO SURJUDPFRQWLQXHG ,16758&7,21&<&/(7,0(6 1RUPDO/'5LQVWUXFWLRQVWDNH61,DQG/'53&WDNH61,LQFUHPHQWDOF\FOHVZKHUH61DQG,DUH GHILQHGDVVTXHQWLDO6F\FOHQRQVHTXHQWLDO1F\FOHDQGLQWHUQDO,F\FOHUHVSHFWLYHO\675LQVWUXFWLRQVWDNH 1LQFUHPHQWDOF\FOHVWRH[HFXWH $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 $66(0%/(56<17$; /'5_675!^FRQG`^%`^7`5G$GGUHVV! ZKHUH /'5 675 ^FRQG` ^%` ^7` /RDGIURPPHPRU\LQWRDUHJLVWHU 6WRUHIURPDUHJLVWHULQWRPHPRU\ 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH ,I%LVSUHVHQWWKHQE\WHWUDQVIHURWKHUZLVHZRUGWUDQVIHU ,I7LVSUHVHQWWKH:ELWZLOOEHVHWLQDSRVWLQGH[HGLQVWUXFWLRQIRUFLQJQRQSULYLOHJHG PRGHIRUWKHWUDQVIHUF\FOH7LVQRWDOORZHGZKHQDSUHLQGH[HGDGGUHVVLQJPRGHLV VSHFLILHGRULPSOLHG $QH[SUHVVLRQHYDOXDWLQJWRDYDOLGUHJLVWHUQXPEHU ([SUHVVLRQVHYDOXDWLQJWRDUHJLVWHUQXPEHU,I5QLV5WKHQWKHDVVHPEOHUZLOO VXEWUDFWIURPWKHRIIVHWYDOXHWRDOORZIRU$507'0,SLSHOLQLQJ,QWKLVFDVHEDVH ZULWHEDFNVKRXOGQRWEHVSHFLILHG $QH[SUHVVLRQZKLFKJHQHUDWHVDQDGGUHVV 7KHDVVHPEOHUZLOODWWHPSWWRJHQHUDWHDQLQVWUXFWLRQXVLQJWKH3&DVDEDVHDQGD FRUUHFWHGLPPHGLDWHRIIVHWWRDGGUHVVWKHORFDWLRQJLYHQE\HYDOXDWLQJWKHH[SUHVVLRQ 7KLVZLOOEHD3&UHODWLYHSUHLQGH[HGDGGUHVV,IWKHDGGUHVVLVRXWRIUDQJHDQHUURU ZLOOEHJHQHUDWHG $SUHLQGH[HGDGGUHVVLQJVSHFLILFDWLRQ >5Q@ RIIVHWRI]HUR >5QH[SUHVVLRQ!@^` RIIVHWRIH[SUHVVLRQ!E\WHV >5Q^`5P^VKLIW!`@^` RIIVHWRIFRQWHQWVRILQGH[UHJLVWHUVKLIWHG E\VKLIW! $SRVWLQGH[HGDGGUHVVLQJVSHFLILFDWLRQ >[email protected][SUHVVLRQ! RIIVHWRIH[SUHVVLRQ!E\WHV >5Q@^`5P^VKLIW!` RIIVHWRIFRQWHQWVRILQGH[UHJLVWHU VKLIWHGDVE\VKLIW! *HQHUDOVKLIWRSHUDWLRQVHHGDWDSURFHVVLQJLQVWUXFWLRQVEXW\RXFDQQRWVSHFLI\WKH VKLIWDPRXQWE\DUHJLVWHU :ULWHVEDFNWKHEDVHUHJLVWHUVHWWKH:ELWLILVSUHVHQW 5G 5QDQG5P $GGUHVV!FDQEH VKLIW! ^` .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 (;$03/(6 675 675 /'5 /'5 /'5(4% 675 3/$&( 5>55@ 5>[email protected] 5>5@ 5>55/6/@ 5>5@ 53/$&( 6WRUH5DW55ERWKRIZKLFKDUHUHJLVWHUV DQGZULWHEDFNDGGUHVVWR5 6WRUH5DW5DQGZULWHEDFN55WR5 /RDG5IURPFRQWHQWVRI5EXWGRQWZULWHEDFN /RDG5IURPFRQWHQWVRI55 &RQGLWLRQDOO\ORDGE\WHDW5LQWR 5ELWVWRILOOLQJELWVWRZLWK]HURV *HQHUDWH3&UHODWLYHRIIVHWWRDGGUHVV3/$&( $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 +$/):25'$1'6,*1(''$7$75$16)(5/'5+675+/'56%/'56+ 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH 7KHVHLQVWUXFWLRQVDUHXVHGWRORDGRUVWRUHKDOIZRUGVRIGDWDDQGDOVRORDGVLJQH[WHQGHGE\WHVRUKDOIZRUGVRI GDWD7KHPHPRU\DGGUHVVXVHGLQWKHWUDQVIHULVFDOFXODWHGE\DGGLQJDQRIIVHWWRRUVXEWUDFWLQJDQRIIVHWIURPD EDVHUHJLVWHU7KHUHVXOWRIWKLVFDOFXODWLRQPD\EHZULWWHQEDFNLQWRWKHEDVHUHJLVWHULIDXWRLQGH[LQJLVUHTXLUHG &RQG 3 8 : / 5Q 5G 6 + 5P >@2IIVHWUHJLVWHU >@>@6+ 6:3LQVWUXFWLRQ 8QVLJQHGKDOIZRUGV 6LJQHGE\WH 6LJQHGKDOIZRUGV >@6RXUFH'HVWLQDWLRQUHJLVWHU >@%DVHUHJLVWHU >@/RDG6WRUH 6WRUHWRPHPRU\ /RDGIURPPHPRU\ >@:ULWHEDFN 1RZULWHEDFN :ULWHDGGUHVVLQWREDVH >@8S'RZQ 'RZQVXEWUDFWRIIVHWIURPEDVH 8SDGGRIIVHWWREDVH >@3UH3RVWLQGH[LQJ 3RVWDGGVXEWUDFWRIIVHWDIWHUWUDQVIHU 3UHDGGVXEWUDFWRIIVHWEHIRUHWUDQVIHU >@&RQGLWLRQILHOG )LJXUH+DOIZRUGDQG6LJQHG'DWD7UDQVIHUZLWK5HJLVWHU2IIVHW .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 &RQG 3 8 : / 5Q 5G 2IIVHW 6 + 2IIVHW >@,PPHGLDWH2IIVHW/RZQLEEOH >@>@6+ 6:3LQVWUXFWLRQ 8QVLJQHGKDOIZRUGV 6LJQHGE\WH 6LJQHGKDOIZRUGV >@,PPHGLDWH2IIVHW+LJKQLEEOH >@6RXUFH'HVWLQDWLRQUHJLVWHU >@%DVHUHJLVWHU >@/RDG6WRUH 6WRUHWRPHPRU\ /RDGIURPPHPRU\ >@:ULWHEDFN 1RZULWHEDFN :ULWHDGGUHVVLQWREDVH >@8S'RZQ 'RZQVXEWUDFWRIIVHWIURPEDVH 8SDGGRIIVHWWREDVH >@3UH3RVWLQGH[LQJ 3RVWDGGVXEWUDFWRIIVHWDIWHUWUDQVIHU 3UHDGGVXEWUDFWRIIVHWEHIRUHWUDQVIHU >@&RQGLWLRQILHOG )LJXUH+DOIZRUGDQG6LJQHG'DWD7UDQVIHUZLWK,PPHGLDWH2IIVHWDQG$XWR,QGH[LQJ 2))6(76$1'$872,1'(;,1* 7KHRIIVHWIURPWKHEDVHPD\EHHLWKHUDELWXQVLJQHGELQDU\LPPHGLDWHYDOXHLQWKHLQVWUXFWLRQRUDVHFRQG UHJLVWHU7KHELWRIIVHWLVIRUPHGE\FRQFDWHQDWLQJELWVWRDQGELWVWRRIWKHLQVWUXFWLRQZRUGVXFKWKDWELW EHFRPHVWKH06%DQGELWEHFRPHVWKH/6%7KHRIIVHWPD\EHDGGHGWR8 RUVXEWUDFWHGIURP8 WKH EDVHUHJLVWHU5Q7KHRIIVHWPRGLILFDWLRQPD\EHSHUIRUPHGHLWKHUEHIRUHSUHLQGH[HG3 RUDIWHUSRVWLQGH[HG 3 WKHEDVHUHJLVWHULVXVHGDVWKHWUDQVIHUDGGUHVV 7KH:ELWJLYHVRSWLRQDODXWRLQFUHPHQWDQGGHFUHPHQWDGGUHVVLQJPRGHV7KHPRGLILHGEDVHYDOXHPD\EH ZULWWHQEDFNLQWRWKHEDVH: RUWKHROGEDVHPD\EHNHSW: ,QWKHFDVHRISRVWLQGH[HGDGGUHVVLQJWKH ZULWHEDFNELWLVUHGXQGDQWDQGLVDOZD\VVHWWR]HURVLQFHWKHROGEDVHYDOXHFDQEHUHWDLQHGLIQHFHVVDU\E\ VHWWLQJWKHRIIVHWWR]HUR7KHUHIRUHSRVWLQGH[HGGDWDWUDQVIHUVDOZD\VZULWHEDFNWKHPRGLILHGEDVH 7KH:ULWHEDFNELWVKRXOGQRWEHVHWKLJK: ZKHQSRVWLQGH[HGDGGUHVVLQJLVVHOHFWHG $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 +$/):25'/2$'$1'6725(6 6HWWLQJ6 DQG+ PD\EHXVHGWRWUDQVIHUXQVLJQHG+DOIZRUGVEHWZHHQDQ$507'0,UHJLVWHUDQGPHPRU\ 7KHDFWLRQRI/'5+DQG675+LQVWUXFWLRQVLVLQIOXHQFHGE\WKH%,*(1'FRQWUROVLJQDO7KHWZRSRVVLEOH FRQILJXUDWLRQVDUHGHVFULEHGLQWKHVHFWLRQEHORZ 6,*1('%<7($1'+$/):25'/2$'6 7KH6ELWFRQWUROVWKHORDGLQJRIVLJQH[WHQGHGGDWD:KHQ6 WKH+ELWVHOHFWVEHWZHHQ%\WHV+ DQG+DOI ZRUGV+ 7KH/ELWVKRXOGQRWEHVHWORZ6WRUHZKHQ6LJQHG6 RSHUDWLRQVKDYHEHHQVHOHFWHG 7KH/'56%LQVWUXFWLRQORDGVWKHVHOHFWHG%\WHLQWRELWVWRRIWKHGHVWLQDWLRQUHJLVWHUDQGELWVWRRIWKH GHVWLQDWLRQUHJLVWHUDUHVHWWRWKHYDOXHRIELWWKHVLJQELW 7KH/'56+LQVWUXFWLRQORDGVWKHVHOHFWHG+DOIZRUGLQWRELWVWRRIWKHGHVWLQDWLRQUHJLVWHUDQGELWVWRRI WKHGHVWLQDWLRQUHJLVWHUDUHVHWWRWKHYDOXHRIELWWKHVLJQELW 7KHDFWLRQRIWKH/'56%DQG/'56+LQVWUXFWLRQVLVLQIOXHQFHGE\WKH%,*(1'FRQWUROVLJQDO7KHWZRSRVVLEOH FRQILJXUDWLRQVDUHGHVFULEHGLQWKHIROORZLQJVHFWLRQ (1',$11(66$1'%<7(+$/):25'6(/(&7,21 /LWWOH(QGLDQ&RQILJXUDWLRQ $VLJQHGE\WHORDG/'56%H[SHFWVGDWDRQGDWDEXVLQSXWVWKURXJKWRLIWKHVXSSOLHGDGGUHVVLVRQDZRUG ERXQGDU\RQGDWDEXVLQSXWVWKURXJKWRLILWLVDZRUGDGGUHVVSOXVRQHE\WHDQGVRRQ7KHVHOHFWHGE\WHLV SODFHGLQWKHERWWRPELWRIWKHGHVWLQDWLRQUHJLVWHUDQGWKHUHPDLQLQJELWVRIWKHUHJLVWHUDUHILOOHGZLWKWKHVLJQELW ELWRIWKHE\WH3OHDVHVHH)LJXUH $KDOIZRUGORDG/'56+RU/'5+H[SHFWVGDWDRQGDWDEXVLQSXWVWKURXJKWRLIWKHVXSSOLHGDGGUHVVLVRQD ZRUGERXQGDU\DQGRQGDWDEXVLQSXWVWKURXJKWRLILWLVDKDOIZRUGERXQGDU\$>@ 7KHVXSSOLHGDGGUHVV VKRXOGDOZD\VEHRQDKDOIZRUGERXQGDU\,IELWRIWKHVXSSOLHGDGGUHVVLV+,*+WKHQWKH$507'0,ZLOOORDGDQ XQSUHGLFWDEOHYDOXH7KHVHOHFWHGKDOIZRUGLVSODFHGLQWKHERWWRPELWVRIWKHGHVWLQDWLRQUHJLVWHU)RUXQVLJQHG KDOIZRUGV/'5+WKHWRSELWVRIWKHUHJLVWHUDUHILOOHGZLWK]HURVDQGIRUVLJQHGKDOIZRUGV/'56+WKHWRS ELWVDUHILOOHGZLWKWKHVLJQELWELWRIWKHKDOIZRUG $KDOIZRUGVWRUH675+UHSHDWVWKHERWWRPELWVRIWKHVRXUFHUHJLVWHUWZLFHDFURVVWKHGDWDEXVRXWSXWV WKURXJKWR7KHH[WHUQDOPHPRU\V\VWHPVKRXOGDFWLYDWHWKHDSSURSULDWHKDOIZRUGVXEV\VWHPWRVWRUHWKHGDWD 1RWHWKDWWKHDGGUHVVPXVWEHKDOIZRUGDOLJQHGLIELWRIWKHDGGUHVVLV+,*+WKLVZLOOFDXVHXQSUHGLFWDEOH EHKDYLRXU .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 %LJ(QGLDQ&RQILJXUDWLRQ $VLJQHGE\WHORDG/'56%H[SHFWVGDWDRQGDWDEXVLQSXWVWKURXJKWRLIWKHVXSSOLHGDGGUHVVLVRQDZRUG ERXQGDU\RQGDWDEXVLQSXWVWKURXJKWRLILWLVDZRUGDGGUHVVSOXVRQHE\WHDQGVRRQ7KHVHOHFWHGE\WHLV SODFHGLQWKHERWWRPELWRIWKHGHVWLQDWLRQUHJLVWHUDQGWKHUHPDLQLQJELWVRIWKHUHJLVWHUDUHILOOHGZLWKWKHVLJQELW ELWRIWKHE\WH3OHDVHVHH)LJXUH $KDOIZRUGORDG/'56+RU/'5+H[SHFWVGDWDRQGDWDEXVLQSXWVWKURXJKWRLIWKHVXSSOLHGDGGUHVVLVRQD ZRUGERXQGDU\DQGRQGDWDEXVLQSXWVWKURXJKWRLILWLVDKDOIZRUGERXQGDU\$>@ 7KHVXSSOLHGDGGUHVV VKRXOGDOZD\VEHRQDKDOIZRUGERXQGDU\,IELWRIWKHVXSSOLHGDGGUHVVLV+,*+WKHQWKH$507'0,ZLOOORDGDQ XQSUHGLFWDEOHYDOXH7KHVHOHFWHGKDOIZRUGLVSODFHGLQWKHERWWRPELWVRIWKHGHVWLQDWLRQUHJLVWHU)RUXQVLJQHG KDOIZRUGV/'5+WKHWRSELWVRIWKHUHJLVWHUDUHILOOHGZLWK]HURVDQGIRUVLJQHGKDOIZRUGV/'56+WKHWRS ELWVDUHILOOHGZLWKWKHVLJQELWELWRIWKHKDOIZRUG $KDOIZRUGVWRUH675+UHSHDWVWKHERWWRPELWVRIWKHVRXUFHUHJLVWHUWZLFHDFURVVWKHGDWDEXVRXWSXWV WKURXJKWR7KHH[WHUQDOPHPRU\V\VWHPVKRXOGDFWLYDWHWKHDSSURSULDWHKDOIZRUGVXEV\VWHPWRVWRUHWKHGDWD 1RWHWKDWWKHDGGUHVVPXVWEHKDOIZRUGDOLJQHGLIELWRIWKHDGGUHVVLV+,*+WKLVZLOOFDXVHXQSUHGLFWDEOH EHKDYLRXU 86(2)5 :ULWHEDFNVKRXOGQRWEHVSHFLILHGLI5LVVSHFLILHGDVWKHEDVHUHJLVWHU5Q:KHQXVLQJ5DVWKHEDVH UHJLVWHU\RXPXVWUHPHPEHULWFRQWDLQVDQDGGUHVVE\WHVRQIURPWKHDGGUHVVRIWKHFXUUHQWLQVWUXFWLRQ 5VKRXOGQRWEHVSHFLILHGDVWKHUHJLVWHURIIVHW5P :KHQ5LVWKHVRXUFHUHJLVWHU5GRID+DOIZRUGVWRUH675+LQVWUXFWLRQWKHVWRUHGDGGUHVVZLOOEHDGGUHVVRI WKHLQVWUXFWLRQSOXV '$7$$%2576 $WUDQVIHUWRRUIURPDOHJDODGGUHVVPD\FDXVHSUREOHPVIRUDPHPRU\PDQDJHPHQWV\VWHP)RULQVWDQFHLQD V\VWHPZKLFKXVHVYLUWXDOPHPRU\WKHUHTXLUHGGDWDPD\EHDEVHQWIURPWKHPDLQPHPRU\7KHPHPRU\PDQDJHU FDQVLJQDODSUREOHPE\WDNLQJWKHSURFHVVRU$%257LQSXW+,*+ZKHUHXSRQWKH'DWD$ERUWWUDSZLOOEHWDNHQ,WLV XSWRWKHV\VWHPVRIWZDUHWRUHVROYHWKHFDXVHRIWKHSUREOHPWKHQWKHLQVWUXFWLRQFDQEHUHVWDUWHGDQGWKHRULJLQDO SURJUDPFRQWLQXHG ,16758&7,21&<&/(7,0(6 1RUPDO/'5+6+6%LQVWUXFWLRQVWDNH61,/'5+6+6%3&WDNH61,LQFUHPHQWDOF\FOHV 61DQG,DUHGHILQHGDVVTXHQWLDO6F\FOHQRQVTXHQWLDO1F\FOHDQGLQWHUQDO,F\FOHUHVSHFWLYHO\675+ LQVWUXFWLRQVWDNH1LQFUHPHQWDOF\FOHVWRH[HFXWH $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 $66(0%/(56<17$; /'5_675!^FRQG`+_6+_6%!5GDGGUHVV! /'5 675 ^FRQG` + 6% 6+ 5G DGGUHVV!FDQEH $QH[SUHVVLRQZKLFKJHQHUDWHVDQDGGUHVV 7KHDVVHPEOHUZLOODWWHPSWWRJHQHUDWHDQLQVWUXFWLRQXVLQJWKH3&DVDEDVHDQGD FRUUHFWHGLPPHGLDWHRIIVHWWRDGGUHVVWKHORFDWLRQJLYHQE\HYDOXDWLQJWKHH[SUHVVLRQ 7KLVZLOOEHD3&UHODWLYHSUHLQGH[HGDGGUHVV,IWKHDGGUHVVLVRXWRIUDQJHDQHUURU ZLOOEHJHQHUDWHG $SUHLQGH[HGDGGUHVVLQJVSHFLILFDWLRQ >5Q@ RIIVHWRI]HUR >5QH[SUHVVLRQ!@^` RIIVHWRIH[SUHVVLRQ!E\WHV >5Q^`5P@^` RIIVHWRIFRQWHQWVRILQGH[UHJLVWHU $SRVWLQGH[HGDGGUHVVLQJVSHFLILFDWLRQ >[email protected][SUHVVLRQ! RIIVHWRIH[SUHVVLRQ!E\WHV >5Q@^`5P RIIVHWRIFRQWHQWVRILQGH[UHJLVWHU 5QDQG5PDUHH[SUHVVLRQVHYDOXDWLQJWRDUHJLVWHUQXPEHU,I5QLV5WKHQWKH DVVHPEOHUZLOOVXEWUDFWIURPWKHRIIVHWYDOXHWRDOORZIRU$507'0,SLSHOLQLQJ,QWKLV FDVHEDVHZULWHEDFNVKRXOGQRWEHVSHFLILHG :ULWHVEDFNWKHEDVHUHJLVWHUVHWWKH:ELWLILVSUHVHQW /RDGIURPPHPRU\LQWRDUHJLVWHU 6WRUHIURPDUHJLVWHULQWRPHPRU\ 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH 7UDQVIHUKDOIZRUGTXDQWLW\ /RDGVLJQH[WHQGHGE\WH2QO\YDOLGIRU/'5 /RDGVLJQH[WHQGHGKDOIZRUG2QO\YDOLGIRU/'5 $QH[SUHVVLRQHYDOXDWLQJWRDYDOLGUHJLVWHUQXPEHU ^` .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 (;$03/(6 /'5+ 5>5@ 5>5@ 5>5@ 5>3&)5('+(5(@ 5>55@ /RDG5IURPWKHFRQWHQWVRIWKHKDOIZRUGDGGUHVV FRQWDLQHGLQ55ERWKRIZKLFKDUHUHJLVWHUV DQGZULWHEDFNDGGUHVVWR5 6WRUHWKHKDOIZRUGLQ5DW5EXWGRQWZULWHEDFN /RDG5ZLWKWKHVLJQH[WHQGHGFRQWHQWVRIWKHE\WH DGGUHVVFRQWDLQHGLQ5DQGZULWHEDFN5WR5 &RQGLWLRQDOO\ORDG5ZLWKWKHVLJQH[WHQGHGFRQWHQWVRI WKHKDOIZRUGDGGUHVVFRQWDLQHGLQ5 *HQHUDWH3&UHODWLYHRIIVHWWRDGGUHVV)5(' 6WRUHWKHKDOIZRUGLQ5DWDGGUHVV)5(' 675+ /'56% /'51(6+ +(5( 675+ )5(' $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 %/2&.'$7$75$16)(5/'0670 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH %ORFNGDWDWUDQVIHULQVWUXFWLRQVDUHXVHGWRORDG/'0RUVWRUH670DQ\VXEVHWRIWKHFXUUHQWO\YLVLEOHUHJLVWHUV 7KH\VXSSRUWDOOSRVVLEOHVWDFNLQJPRGHVPDLQWDLQLQJIXOORUHPSW\VWDFNVZKLFKFDQJURZXSRUGRZQPHPRU\ DQGDUHYHU\HIILFLHQWLQVWUXFWLRQVIRUVDYLQJRUUHVWRULQJFRQWH[WRUIRUPRYLQJODUJHEORFNVRIGDWDDURXQGPDLQ PHPRU\ 7+(5(*,67(5/,67 7KHLQVWUXFWLRQFDQFDXVHWKHWUDQVIHURIDQ\UHJLVWHUVLQWKHFXUUHQWEDQNDQGQRQXVHUPRGHSURJUDPVFDQDOVR WUDQVIHUWRDQGIURPWKHXVHUEDQNVHHEHORZ7KHUHJLVWHUOLVWLVDELWILHOGLQWKHLQVWUXFWLRQZLWKHDFKELW FRUUHVSRQGLQJWRDUHJLVWHU$LQELWRIWKHUHJLVWHUILHOGZLOOFDXVH5WREHWUDQVIHUUHGDZLOOFDXVHLWQRWWREH WUDQVIHUUHGVLPLODUO\ELWFRQWUROVWKHWUDQVIHURI5DQGVRRQ $Q\VXEVHWRIWKHUHJLVWHUVRUDOOWKHUHJLVWHUVPD\EHVSHFLILHG7KHRQO\UHVWULFWLRQLVWKDWWKHUHJLVWHUOLVWVKRXOG QRWEHHPSW\ :KHQHYHU5LVVWRUHGWRPHPRU\WKHVWRUHGYDOXHLVWKHDGGUHVVRIWKH670LQVWUXFWLRQSOXV &RQG 3 8 6 : / 5Q 5HJLVWHUOLVW >@%DVHUHJLVWHU >@/RDG6WRUHELW 6WRUHWRPHPRU\ /RDGIURPPHPRU\ >@:ULWHEDFNELW 1RZULWHEDFN :ULWHDGGUHVVLQWREDVH >>@365IRUFHXVHUELW 'RQRWORDG365RUIRUFHXVHUPRGH /RDG365RUIRUFHXVHUPRGH >@8S'RZQELW 'RZQVXEWUDFNRIIVHWIURPEDVH 8SDGGRIIVHWWREDVH >@3UH3RVWLQGH[LQJELW 3RVWDGGRIIVHWDIWHUWUDQVIHU 3UHDGGRIIVHWEHIRUHWUDQVIHU >@&RQGLWLRQILHOG )LJXUH%ORFN'DWD7UDQVIHU,QVWUXFWLRQV .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 $''5(66,1*02'(6 7KHWUDQVIHUDGGUHVVHVDUHGHWHUPLQHGE\WKHFRQWHQWVRIWKHEDVHUHJLVWHU5QWKHSUHSRVWELW3DQGWKHXS GRZQELW87KHUHJLVWHUVDUHWUDQVIHUUHGLQWKHRUGHUORZHVWWRKLJKHVWVR5LILQWKHOLVWZLOODOZD\VEH WUDQVIHUUHGODVW7KHORZHVWUHJLVWHUDOVRJHWVWUDQVIHUUHGWRIURPWKHORZHVWPHPRU\DGGUHVV%\ZD\RILOOXVWUDWLRQ FRQVLGHUWKHWUDQVIHURI55DQG5LQWKHFDVHZKHUH5Q [DQGZULWHEDFNRIWKHPRGLILHGEDVHLV UHTXLUHG: )LJXUHVKRZWKHVHTXHQFHRIUHJLVWHUWUDQVIHUVWKHDGGUHVVHVXVHGDQGWKHYDOXHRI5Q DIWHUWKHLQVWUXFWLRQKDVFRPSOHWHG ,QDOOFDVHVKDGZULWHEDFNRIWKHPRGLILHGEDVHQRWEHHQUHTXLUHG: 5QZRXOGKDYHUHWDLQHGLWVLQLWLDOYDOXHRI [XQOHVVLWZDVDOVRLQWKHWUDQVIHUOLVWRIDORDGPXOWLSOHUHJLVWHULQVWUXFWLRQZKHQLWZRXOGKDYHEHHQ RYHUZULWWHQZLWKWKHORDGHGYDOXH $''5(66$/,*10(17 7KHDGGUHVVVKRXOGQRUPDOO\EHDZRUGDOLJQHGTXDQWLW\DQGQRQZRUGDOLJQHGDGGUHVVHVGRQRWDIIHFWWKH LQVWUXFWLRQ+RZHYHUWKHERWWRPELWVRIWKHDGGUHVVZLOODSSHDURQ$>@DQGPLJKWEHLQWHUSUHWHGE\WKH PHPRU\V\VWHP [& [& 5Q [ 5 [ [)) [)) [& 5 5 5Q [& 5 5 5 [ [ [)) [)) )LJXUH3RVW,QFUHPHQW$GGUHVVLQJ $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 [& 5 5Q [ [& [ [)) [)) [& 5 5 [ 5Q 5 5 5 [& [ [)) [)) )LJXUH3UH,QFUHPHQW$GGUHVVLQJ [& [& 5Q [ 5 [)) [ [)) [& [& [ 5 5 [)) 5Q 5 5 5 [ [)) )LJXUH3RVW'HFUHPHQW$GGUHVVLQJ .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 [& [& 5Q [ [ [)) 5 [)) [& [& [ 5 5 5 5 5 [ [)) 5Q [)) )LJXUH3UH'HFUHPHQW$GGUHVVLQJ 86(2)7+(6%,7 :KHQWKH6ELWLVVHWLQD/'0670LQVWUXFWLRQLWVPHDQLQJGHSHQGVRQZKHWKHURUQRW5LVLQWKHWUDQVIHUOLVWDQG RQWKHW\SHRILQVWUXFWLRQ7KH6ELWVKRXOGRQO\EHVHWLIWKHLQVWUXFWLRQLVWRH[HFXWHLQDSULYLOHJHGPRGH /'0ZLWK5LQ7UDQVIHU/LVWDQG6%LW6HW0RGH&KDQJHV ,IWKHLQVWUXFWLRQLVD/'0WKHQ6365BPRGH!LVWUDQVIHUUHGWR&365DWWKHVDPHWLPHDV5LVORDGHG 670ZLWK5LQ7UDQVIHU/LVWDQG6%LW6HW8VHU%DQN7UDQVIHU 7KHUHJLVWHUVWUDQVIHUUHGDUHWDNHQIURPWKH8VHUEDQNUDWKHUWKDQWKHEDQNFRUUHVSRQGLQJWRWKHFXUUHQWPRGH 7KLVLVXVHIXOIRUVDYLQJWKHXVHUVWDWHRQSURFHVVVZLWFKHV%DVHZULWHEDFNVKRXOGQRWEHXVHGZKHQWKLV PHFKDQLVPLVHPSOR\HG 5QRWLQ/LVWDQG6%LW6HW8VHU%DQN7UDQVIHU )RUERWK/'0DQG670LQVWUXFWLRQVWKH8VHUEDQNUHJLVWHUVDUHWUDQVIHUUHGUDWKHUWKDQWKHUHJLVWHUEDQN FRUUHVSRQGLQJWRWKHFXUUHQWPRGH7KLVLVXVHIXOIRUVDYLQJWKHXVHUVWDWHRQSURFHVVVZLWFKHV%DVHZULWHEDFN VKRXOGQRWEHXVHGZKHQWKLVPHFKDQLVPLVHPSOR\HG :KHQWKHLQVWUXFWLRQLV/'0FDUHPXVWEHWDNHQQRWWRUHDGIURPDEDQNHGUHJLVWHUGXULQJWKHIROORZLQJF\FOH LQVHUWLQJDGXPP\LQVWUXFWLRQVXFKDV02955DIWHUWKH/'0ZLOOHQVXUHVDIHW\ 86(2)5$67+(%$6( 5VKRXOGQRWEHXVHGDVWKHEDVHUHJLVWHULQDQ\/'0RU670LQVWUXFWLRQ $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,1&/86,212)7+(%$6(,17+(5(*,67(5/,67 :KHQZULWHEDFNLVVSHFLILHGWKHEDVHLVZULWWHQEDFNDWWKHHQGRIWKHVHFRQGF\FOHRIWKHLQVWUXFWLRQ'XULQJD 670WKHILUVWUHJLVWHULVZULWWHQRXWDWWKHVWDUWRIWKHVHFRQGF\FOH$670ZKLFKLQFOXGHVVWRULQJWKHEDVHZLWKWKH EDVHDVWKHILUVWUHJLVWHUWREHVWRUHGZLOOWKHUHIRUHVWRUHWKHXQFKDQJHGYDOXHZKHUHDVZLWKWKHEDVHVHFRQGRU ODWHULQWKHWUDQVIHURUGHUZLOOVWRUHWKHPRGLILHGYDOXH$/'0ZLOODOZD\VRYHUZULWHWKHXSGDWHGEDVHLIWKHEDVHLV LQWKHOLVW '$7$$%2576 6RPHOHJDODGGUHVVHVPD\EHXQDFFHSWDEOHWRDPHPRU\PDQDJHPHQWV\VWHPDQGWKHPHPRU\PDQDJHUFDQ LQGLFDWHDSUREOHPZLWKDQDGGUHVVE\WDNLQJWKH$%257VLJQDO+,*+7KLVFDQKDSSHQRQDQ\WUDQVIHUGXULQJD PXOWLSOHUHJLVWHUORDGRUVWRUHDQGPXVWEHUHFRYHUDEOHLI$507'0,LVWREHXVHGLQDYLUWXDOPHPRU\V\VWHP $ERUWVGXULQJ670,QVWUXFWLRQV ,IWKHDERUWRFFXUVGXULQJDVWRUHPXOWLSOHLQVWUXFWLRQ$507'0,WDNHVOLWWOHDFWLRQXQWLOWKHLQVWUXFWLRQFRPSOHWHV ZKHUHXSRQLWHQWHUVWKHGDWDDERUWWUDS7KHPHPRU\PDQDJHULVUHVSRQVLEOHIRUSUHYHQWLQJHUURQHRXVZULWHVWRWKH PHPRU\7KHRQO\FKDQJHWRWKHLQWHUQDOVWDWHRIWKHSURFHVVRUZLOOEHWKHPRGLILFDWLRQRIWKHEDVHUHJLVWHULIZULWH EDFNZDVVSHFLILHGDQGWKLVPXVWEHUHYHUVHGE\VRIWZDUHDQGWKHFDXVHRIWKHDERUWUHVROYHGEHIRUHWKH LQVWUXFWLRQPD\EHUHWULHG $ERUWVGXULQJ/'0,QVWUXFWLRQV :KHQ$507'0,GHWHFWVDGDWDDERUWGXULQJDORDGPXOWLSOHLQVWUXFWLRQLWPRGLILHVWKHRSHUDWLRQRIWKHLQVWUXFWLRQ WRHQVXUHWKDWUHFRYHU\LVSRVVLEOH 2YHUZULWLQJRIUHJLVWHUVVWRSVZKHQWKHDERUWKDSSHQV7KHDERUWLQJORDGZLOOQRWWDNHSODFHEXWHDUOLHURQHV PD\KDYHRYHUZULWWHQUHJLVWHUV7KH3&LVDOZD\VWKHODVWUHJLVWHUWREHZULWWHQDQGVRZLOODOZD\VEH SUHVHUYHG 7KHEDVHUHJLVWHULVUHVWRUHGWRLWVPRGLILHGYDOXHLIZULWHEDFNZDVUHTXHVWHG7KLVHQVXUHVUHFRYHUDELOLW\LQ WKHFDVHZKHUHWKHEDVHUHJLVWHULVDOVRLQWKHWUDQVIHUOLVWDQGPD\KDYHEHHQRYHUZULWWHQEHIRUHWKHDERUW RFFXUUHG 7KHGDWDDERUWWUDSLVWDNHQZKHQWKHORDGPXOWLSOHKDVFRPSOHWHGDQGWKHV\VWHPVRIWZDUHPXVWXQGRDQ\EDVH PRGLILFDWLRQDQGUHVROYHWKHFDXVHRIWKHDERUWEHIRUHUHVWDUWLQJWKHLQVWUXFWLRQ ,16758&7,21&<&/(7,0(6 1RUPDO/'0LQVWUXFWLRQVWDNHQ61,DQG/'03&WDNHVQ61,LQFUHPHQWDOF\FOHVZKHUH61DQG ,DUHGHILQHGDVVTXHQWLDO6F\FOHQRQVHTXHQWLDO1F\FOHDQGLQWHUQDO,F\FOHUHVSHFWLYHO\670LQVWUXFWLRQV WDNHQ61LQFUHPHQWDOF\FOHVWRH[HFXWHZKHUHQLVWKHQXPEHURIZRUGVWUDQVIHUUHG .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 $66(0%/(56<17$; /'0_670!^FRQG`)'_('_)$_($_,$_,%_'$_'%!5Q^`5OLVW!^A` ZKHUH ^FRQG` 5Q 5OLVW! ^` ^A` 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH $QH[SUHVVLRQHYDOXDWLQJWRDYDOLGUHJLVWHUQXPEHU $OLVWRIUHJLVWHUVDQGUHJLVWHUUDQJHVHQFORVHGLQ^`HJ^5555` ,ISUHVHQWUHTXHVWVZULWHEDFN: RWKHUZLVH: ,ISUHVHQWVHW6ELWWRORDGWKH&365DORQJZLWKWKH3&RUIRUFHWUDQVIHURIXVHUEDQN ZKHQLQSULYLOHJHGPRGH $GGUHVVLQJ0RGH1DPHV 7KHUHDUHGLIIHUHQWDVVHPEOHUPQHPRQLFVIRUHDFKRIWKHDGGUHVVLQJPRGHVGHSHQGLQJRQZKHWKHUWKHLQVWUXFWLRQ LVEHLQJXVHGWRVXSSRUWVWDFNVRUIRURWKHUSXUSRVHV7KHHTXLYDOHQFHEHWZHHQWKHQDPHVDQGWKHYDOXHVRIWKH ELWVLQWKHLQVWUXFWLRQDUHVKRZQLQWKHIROORZLQJWDEOH 7DEOH$GGUHVVLQJ0RGH1DPHV 1DPH 3UH,QFUHPHQW/RDG 3RVW,QFUHPHQW/RDG 3UH'FUHPHQW/RDG 3RVW'HFUHPHQW/RDG 3UH,QFUHPHQW6WRUH 3RVW,QFUHPHQW6WRUH 3UH'HFUHPHQW6WRUH 3RVW'HFUHPHQW6WRUH 6WDFN /'0(' /'0)' /'0($ /'0)$ 670)$ 670($ 670)' 670(' 2WKHU /'0,% /'0,$ /'0'% /'0'$ 670,% 670,$ 670'% 670'$ /ELW 3ELW 8ELW )'(')$($GHILQHSUHSRVWLQGH[LQJDQGWKHXSGRZQELWE\UHIHUHQFHWRWKHIRUPRIVWDFNUHTXLUHG7KH)DQG (UHIHUWRDIXOORUHPSW\VWDFNLHZKHWKHUDSUHLQGH[KDVWREHGRQHIXOOEHIRUHVWRULQJWRWKHVWDFN7KH$ DQG'UHIHUWRZKHWKHUWKHVWDFNLVDVFHQGLQJRUGHVFHQGLQJ,IDVFHQGLQJD670ZLOOJRXSDQG/'0GRZQLI GHVFHQGLQJYLFHYHUVD ,$,%'$'%DOORZFRQWUROZKHQ/'0670DUHQRWEHLQJXVHGIRUVWDFNVDQGVLPSO\PHDQ,QFUHPHQW$IWHU ,QFUHPHQW%HIRUH'HFUHPHQW$IWHU'HFUHPHQW%HIRUH $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 (;$03/(6 /'0)' 670,$ /'0)' /'0)' 670)' 63^555` 5^55` 63^5` 63^5`A 5^55`A 8QVWDFNUHJLVWHUV 6DYHDOOUHJLVWHUV 563&365XQFKDQJHG 563&3656365BPRGH DOORZHGRQO\LQSULYLOHJHGPRGHV 6DYHXVHUPRGHUHJVRQVWDFN DOORZHGRQO\LQSULYLOHJHGPRGHV 7KHVHLQVWUXFWLRQVPD\EHXVHGWRVDYHVWDWHRQVXEURXWLQHHQWU\DQGUHVWRUHLWHIILFLHQWO\RQUHWXUQWRWKHFDOOLQJ URXWLQH 670(' %/ /'0(' 63^555` VRPHZKHUH 63^555` 6DYH5WR5WRXVHDVZRUNVSDFH DQG5IRUUHWXUQLQJ 7KLVQHVWHGFDOOZLOORYHUZULWH5 5HVWRUHZRUNVSDFHDQGUHWXUQ .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 6,1*/('$7$6:$36:3 &RQG % 5Q 5G 5P >@6RXUFHUHJLVWHU >@'HVWLQDWLRQUHJLVWHU >@%DVHUHJLVWHU >@%\WH:RUGELW 6ZDSZRUGTXDQWLW\ 6ZDSZRUGTXDQWLW\ >@&RQGLWLRQILHOG )LJXUH6ZDS,QVWUXFWLRQ 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH 7KHGDWDVZDSLQVWUXFWLRQLVXVHGWRVZDSDE\WHRUZRUGTXDQWLW\EHWZHHQDUHJLVWHUDQGH[WHUQDOPHPRU\7KLV LQVWUXFWLRQLVLPSOHPHQWHGDVDPHPRU\UHDGIROORZHGE\DPHPRU\ZULWHZKLFKDUHORFNHGWRJHWKHUWKH SURFHVVRUFDQQRWEHLQWHUUXSWHGXQWLOERWKRSHUDWLRQVKDYHFRPSOHWHGDQGWKHPHPRU\PDQDJHULVZDUQHGWRWUHDW WKHPDVLQVHSDUDEOH7KLVFODVVRILQVWUXFWLRQLVSDUWLFXODUO\XVHIXOIRULPSOHPHQWLQJVRIWZDUHVHPDSKRUHV 7KHVZDSDGGUHVVLVGHWHUPLQHGE\WKHFRQWHQWVRIWKHEDVHUHJLVWHU5Q7KHSURFHVVRUILUVWUHDGVWKHFRQWHQWVRI WKHVZDSDGGUHVV7KHQLWZULWHVWKHFRQWHQWVRIWKHVRXUFHUHJLVWHU5PWRWKHVZDSDGGUHVVDQGVWRUHVWKHROG PHPRU\FRQWHQWVLQWKHGHVWLQDWLRQUHJLVWHU5G7KHVDPHUHJLVWHUPD\EHVSHFLILHGDVERWKWKHVRXUFHDQG GHVWLQDWLRQ 7KH/2&.RXWSXWJRHV+,*+IRUWKHGXUDWLRQRIWKHUHDGDQGZULWHRSHUDWLRQVWRVLJQDOWRWKHH[WHUQDOPHPRU\ PDQDJHUWKDWWKH\DUHORFNHGWRJHWKHUDQGVKRXOGEHDOORZHGWRFRPSOHWHZLWKRXWLQWHUUXSWLRQ7KLVLVLPSRUWDQWLQ PXOWLSURFHVVRUV\VWHPVZKHUHWKHVZDSLQVWUXFWLRQLVWKHRQO\LQGLYLVLEOHLQVWUXFWLRQZKLFKPD\EHXVHGWR LPSOHPHQWVHPDSKRUHVFRQWURORIWKHPHPRU\PXVWQRWEHUHPRYHGIURPDSURFHVVRUZKLOHLWLVSHUIRUPLQJD ORFNHGRSHUDWLRQ %<7(6$1':25'6 7KLVLQVWUXFWLRQFODVVPD\EHXVHGWRVZDSDE\WH% RUDZRUG% EHWZHHQDQ$507'0,UHJLVWHUDQG PHPRU\7KH6:3LQVWUXFWLRQLVLPSOHPHQWHGDVD/'5IROORZHGE\D675DQGWKHDFWLRQRIWKHVHLVDVGHVFULEHG LQWKHVHFWLRQRQVLQJOHGDWDWUDQVIHUV,QSDUWLFXODUWKHGHVFULSWLRQRI%LJDQG/LWWOH(QGLDQFRQILJXUDWLRQDSSOLHVWR WKH6:3LQVWUXFWLRQ 86(2)5 'RQRWXVH5DVDQRSHUDQG5G5QRU5VLQD6:3LQVWUXFWLRQ $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 '$7$$%2576 ,IWKHDGGUHVVXVHGIRUWKHVZDSLVXQDFFHSWDEOHWRDPHPRU\PDQDJHPHQWV\VWHPWKHPHPRU\PDQDJHUFDQIODJ WKHSUREOHPE\GULYLQJ$%257+,*+7KLVFDQKDSSHQRQHLWKHUWKHUHDGRUWKHZULWHF\FOHRUERWKDQGLQHLWKHU FDVHWKH'DWD$ERUWWUDSZLOOEHWDNHQ,WLVXSWRWKHV\VWHPVRIWZDUHWRUHVROYHWKHFDXVHRIWKHSUREOHPWKHQWKH LQVWUXFWLRQFDQEHUHVWDUWHGDQGWKHRULJLQDOSURJUDPFRQWLQXHG ,16758&7,21&<&/(7,0(6 6ZDSLQVWUXFWLRQVWDNH61,LQFUHPHQWDOF\FOHVWRH[HFXWHZKHUH61DQG,DUHGHILQHGDVVTXHQWLDO6 F\FOHQRQVTXHQWLDODQGLQWHUQDO,F\FOHUHVSHFWLYHO\ $66(0%/(56<17$; 6:3!^FRQG`^%`5G5P>5Q@ ^FRQG` ^%` 5G5P5Q (;$03/(6 6:3 6:3% 6:3(4 55>5@ 55>5@ 55>5@ /RDG5ZLWKWKHZRUGDGGUHVVHGE\5DQG VWRUH5DW5 /RDG5ZLWKWKHE\WHDGGUHVVHGE\5DQG VWRUHELWVWRRI5DW5 &RQGLWLRQDOO\VZDSWKHFRQWHQWVRIWKH ZRUGDGGUHVVHGE\5ZLWK5 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH ,I%LVSUHVHQWWKHQE\WHWUDQVIHURWKHUZLVHZRUGWUDQVIHU ([SUHVVLRQVHYDOXDWLQJWRYDOLGUHJLVWHUQXPEHUV .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 62)7:$5(,17(558376:, 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUHEHORZ &RQG &RPPHQWILHOGLJQRUHGE\3URFHVVRU >@&RQGLWLRQILHOG )LJXUH6RIWZDUH,QWHUUXSW,QVWUXFWLRQ 7KHVRIWZDUHLQWHUUXSWLQVWUXFWLRQLVXVHGWRHQWHU6XSHUYLVRUPRGHLQDFRQWUROOHGPDQQHU7KHLQVWUXFWLRQFDXVHV WKHVRIWZDUHLQWHUUXSWWUDSWREHWDNHQZKLFKHIIHFWVWKHPRGHFKDQJH7KH3&LVWKHQIRUFHGWRDIL[HGYDOXH [DQGWKH&365LVVDYHGLQ6365BVYF,IWKH6:,YHFWRUDGGUHVVLVVXLWDEO\SURWHFWHGE\H[WHUQDOPHPRU\ PDQDJHPHQWKDUGZDUHIURPPRGLILFDWLRQE\WKHXVHUDIXOO\SURWHFWHGRSHUDWLQJV\VWHPPD\EHFRQVWUXFWHG 5(7851)5207+(683(59,625 7KH3&LVVDYHGLQ5BVYFXSRQHQWHULQJWKHVRIWZDUHLQWHUUXSWWUDSZLWKWKH3&DGMXVWHGWRSRLQWWRWKHZRUG DIWHUWKH6:,LQVWUXFWLRQ02963&5BVYFZLOOUHWXUQWRWKHFDOOLQJSURJUDPDQGUHVWRUHWKH&365 1RWHWKDWWKHOLQNPHFKDQLVPLVQRWUHHQWUDQWVRLIWKHVXSHUYLVRUFRGHZLVKHVWRXVHVRIWZDUHLQWHUUXSWVZLWKLQ LWVHOILWPXVWILUVWVDYHDFRS\RIWKHUHWXUQDGGUHVVDQG6365 &200(17),(/' 7KHERWWRPELWVRIWKHLQVWUXFWLRQDUHLJQRUHGE\WKHSURFHVVRUDQGPD\EHXVHGWRFRPPXQLFDWHLQIRUPDWLRQWR WKHVXSHUYLVRUFRGH)RULQVWDQFHWKHVXSHUYLVRUPD\ORRNDWWKLVILHOGDQGXVHLWWRLQGH[LQWRDQDUUD\RIHQWU\ SRLQWVIRUURXWLQHVZKLFKSHUIRUPWKHYDULRXVVXSHUYLVRUIXQFWLRQV ,16758&7,21&<&/(7,0(6 6RIWZDUHLQWHUUXSWLQVWUXFWLRQVWDNH61LQFUHPHQWDOF\FOHVWRH[HFXWHZKHUH6DQG1DUHGHILQHGDVVTXHQWLDO 6F\FOHDQGQRQVTXHQWLDO1F\FOH $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 $66(0%/(56<17$; 6:,^FRQG`H[SUHVVLRQ! ^FRQG` H[SUHVVLRQ! (;$03/(6 6:, 6:, 6:,1( 6XSHUYLVRUFRGH 7KHSUHYLRXVH[DPSOHVDVVXPHWKDWVXLWDEOHVXSHUYLVRUFRGHH[LVWVIRULQVWDQFH [%6XSHUYLVRU (QWU\7DEOH '&'=HUR5WQ '&'5HDG&5WQ '&':ULWH,5WQ (48 (48 (48 6XSHUYLVRU 670)' /'5 %,& 029 $'5 /'5 :ULWH,5WQ /'0)' 5^555` 5>5@ 55[)) 55/65 5(QWU\7DEOH 5>55/6/@ 6:,HQWU\SRLQW $GGUHVVHVRIVXSHUYLVRUURXWLQHV 5HDG& :ULWH,N *HWQH[WFKDUDFWHUIURPUHDGVWUHDP 2XWSXWDNWRWKHZULWHVWUHDP &RQGLWLRQDOO\FDOOVXSHUYLVRUZLWKLQFRPPHQWILHOG 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF7DEOH (YDOXDWHGDQGSODFHGLQWKHFRPPHQWILHOGZKLFKLVLJQRUHGE\$507'0, =HUR 5HDG& :ULWH, 6:,KDVURXWLQHUHTXLUHGLQELWVDQGGDWDLIDQ\LQ ELWV$VVXPHV5BVYFSRLQWVWRDVXLWDEOHVWDFN 6DYHZRUNUHJLVWHUVDQGUHWXUQDGGUHVV *HW6:,LQVWUXFWLRQ &OHDUWRSELWV *HWURXWLQHRIIVHW *HWVWDUWDGGUHVVRIHQWU\WDEOH %UDQFKWRDSSURSULDWHURXWLQH (QWHUZLWKFKDUDFWHULQ5ELWV 5^555`A 5HVWRUHZRUNVSDFHDQGUHWXUQ UHVWRULQJSURFHVVRUPRGHDQGIODJV .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 &2352&(6625'$7$23(5$7,216&'3 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH 7KLVFODVVRILQVWUXFWLRQLVXVHGWRWHOODFRSURFHVVRUWRSHUIRUPVRPHLQWHUQDORSHUDWLRQ1RUHVXOWLVFRPPXQLFDWHG EDFNWR$507'0,DQGLWZLOOQRWZDLWIRUWKHRSHUDWLRQWRFRPSOHWH7KHFRSURFHVVRUFRXOGFRQWDLQDTXHXHRI VXFKLQVWUXFWLRQVDZDLWLQJH[HFXWLRQDQGWKHLUH[HFXWLRQFDQRYHUODSRWKHUDFWLYLW\DOORZLQJWKHFRSURFHVVRUDQG $507'0,WRSHUIRUPLQGHSHQGHQWWDVNVLQSDUDOOHO &2352&(6625,16758&7,216 7KH.6&XQOLNHVRPHRWKHU$50EDVHGSURFHVVRUVGRHVQRWKDYHDQH[WHUQDOFRSURFHVVRULQWHUIDFH,W GRHVQRWKDYHDRQFKLSFRSURFHVVRUDOVR 6RWKHQDOOFRSURFHVVRULQVWUXFWLRQVZLOOFDXVHWKHXQGHILQGHGLQVWUXFWLRQWUDSWREHWDNHQRQWKH.6& 7KHVHFRSURFHVVRULQVWUXFWLRQVFDQEHHPXODWHGE\WKHXQGHILQHGWUDSKDQGOHU(YHQWKRXJKH[WHUQDOFRSURFHVVRU FDQQRWEHFRQQHFWHGWRWKH.6&WKHFRSURFHVVRULQVWUXFWLRQVDUHVWLOOGHVFULEHGKHUHLQIXOOIRU FRPSOHWHQHVV5HPHPEHUWKDWDQ\H[WHUQDOFRSURFHVVRUGHVFULEHGLQWKLVVHFWLRQLVDVRIWZDUHHPXODWLRQ &RQG &32SF &5Q &5G &3 &3 &5P >@&RSURFHVVRURSHUDQGUHJLVWHU >@&RSURFHVVRULQIRUPDWLRQ >@&RSURFHVVRUQXPEHU >@&RSURFHVVRUGHVWLQDWLRQUHJLVWHU >@&RSURFHVVRURSHUDQGUHJLVWHU >@&RSURFHVVRURSHUDWLRQFRGH >@&RQGLWLRQILHOG )LJXUH&RSURFHVVRU'DWD2SHUDWLRQ,QVWUXFWLRQ 7+(&2352&(6625),(/'6 2QO\ELWDQGELWVWRDUHVLJQLILFDQWWR$507'0,7KHUHPDLQLQJELWVDUHXVHGE\FRSURFHVVRUV7KHDERYH ILHOGQDPHVDUHXVHGE\FRQYHQWLRQDQGSDUWLFXODUFRSURFHVVRUVPD\UHGHILQHWKHXVHRIDOOILHOGVH[FHSW&3DV DSSURSULDWH7KH&3ILHOGLVXVHGWRFRQWDLQDQLGHQWLI\LQJQXPEHULQWKHUDQJHWRIRUHDFKFRSURFHVVRUDQG DFRSURFHVVRUZLOOLJQRUHDQ\LQVWUXFWLRQZKLFKGRHVQRWFRQWDLQLWVQXPEHULQWKH&3ILHOG 7KHFRQYHQWLRQDOLQWHUSUHWDWLRQRIWKHLQVWUXFWLRQLVWKDWWKHFRSURFHVVRUVKRXOGSHUIRUPDQRSHUDWLRQVSHFLILHGLQ WKH&32SFILHOGDQGSRVVLEO\LQWKH&3ILHOGRQWKHFRQWHQWVRI&5QDQG&5PDQGSODFHWKHUHVXOWLQ&5G $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,21&<&/(7,0(6 &RSURFHVVRUGDWDRSHUDWLRQVWDNH6E,LQFUHPHQWDOF\FOHVWRH[HFXWHZKHUHELVWKHQXPEHURIF\FOHVVSHQWLQ WKHFRSURFHVVRUEXV\ZDLWORRS 6DQG,DUHGHILQHGDVVTXHQWLDO6F\FOHDQGLQWHUQDO,F\FOH $66(0%/(56<17$; &'3^FRQG`SH[SUHVVLRQ!FGFQFP^H[SUHVVLRQ!` ^FRQG` S H[SUHVVLRQ! FGFQDQGFP H[SUHVVLRQ! (;$03/(6 &'3 &'3(4 SFFF SFFF 5HTXHVWFRSURFWRGRRSHUDWLRQ RQ&5DQG&5DQGSXWWKHUHVXOWLQ&5 ,I=IODJLVVHWUHTXHVWFRSURFWRGRRSHUDWLRQW\SH RQ&5DQG&5DQGSXWWKHUHVXOWLQ&5 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH 7KHXQLTXHQXPEHURIWKHUHTXLUHGFRSURFHVVRU (YDOXDWHGWRDFRQVWDQWDQGSODFHGLQWKH&32SFILHOG (YDOXDWHWRWKHYDOLGFRSURFHVVRUUHJLVWHUQXPEHUV&5G&5QDQG&5PUHVSHFWLYHO\ :KHUHSUHVHQWLVHYDOXDWHGWRDFRQVWDQWDQGSODFHGLQWKH&3ILHOG .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 &2352&(6625'$7$75$16)(56/'&67& 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH 7KLVFODVVRILQVWUXFWLRQLVXVHGWRORDG/'&RUVWRUH67&DVXEVHWRIDFRSURFHVVRUVVUHJLVWHUVGLUHFWO\WR PHPRU\$507'0,LVUHVSRQVLEOHIRUVXSSO\LQJWKHPHPRU\DGGUHVVDQGWKHFRSURFHVVRUVXSSOLHVRUDFFHSWV WKHGDWDDQGFRQWUROVWKHQXPEHURIZRUGVWUDQVIHUUHG &RQG 3 8 1 : / 5Q &5G &3 2IIVHW >@8QVLJQHGELWLPPHGLDWHRIIVHW >@&RSURFHVVRUQXPEHU >@&RSURFHVVRUVRXUFHGHVWLQDWLRQUHJLVWHU >@%DVHUHJLVWHU >@/RDG6WRUHELW 6WRUHWRPHPRU\ /RDGIURPPHPRU\ >@:ULWHEDFNELW 1RZULWHEDFN :ULWHDGGUHVVLQWREDVH >@7UDQVIHUOHQJWK >@8S'RZQELW 'RZQVXEWUDFWRIIVHWIURPEDVH 8SDGGRIIVHWWREDVH >@3UH3RVWLQGH[LQJELW 3RVWDGGRIIVHWDIWHUWUDQVIHU 3UHDGGRIIVHWEHIRUHWUDQVIHU >@&RQGLWLRQILHOG )LJXUH&RSURFHVVRU'DWD7UDQVIHU,QVWUXFWLRQV 7+(&2352&(6625),(/'6 7KH&3ILHOGLVXVHGWRLGHQWLI\WKHFRSURFHVVRUZKLFKLVUHTXLUHGWRVXSSO\RUDFFHSWWKHGDWDDQGDFRSURFHVVRU ZLOORQO\UHVSRQGLILWVQXPEHUPDWFKHVWKHFRQWHQWVRIWKLVILHOG 7KH&5GILHOGDQGWKH1ELWFRQWDLQLQIRUPDWLRQIRUWKHFRSURFHVVRUZKLFKPD\EHLQWHUSUHWHGLQGLIIHUHQWZD\VE\ GLIIHUHQWFRSURFHVVRUVEXWE\FRQYHQWLRQ&5GLVWKHUHJLVWHUWREHWUDQVIHUUHGRUWKHILUVWUHJLVWHUZKHUHPRUHWKDQ RQHLVWREHWUDQVIHUUHGDQGWKH1ELWLVXVHGWRFKRRVHRQHRIWZRWUDQVIHUOHQJWKRSWLRQV)RULQVWDQFH1 FRXOG VHOHFWWKHWUDQVIHURIDVLQJOHUHJLVWHUDQG1 FRXOGVHOHFWWKHWUDQVIHURIDOOWKHUHJLVWHUVIRUFRQWH[WVZLWFKLQJ $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 $''5(66,1*02'(6 $507'0,LVUHVSRQVLEOHIRUSURYLGLQJWKHDGGUHVVXVHGE\WKHPHPRU\V\VWHPIRUWKHWUDQVIHUDQGWKH DGGUHVVLQJPRGHVDYDLODEOHDUHDVXEVHWRIWKRVHXVHGLQVLQJOHGDWDWUDQVIHULQVWUXFWLRQV1RWHKRZHYHUWKDWWKH LPPHGLDWHRIIVHWVDUHELWVZLGHDQGVSHFLI\ZRUGRIIVHWVIRUFRSURFHVVRUGDWDWUDQVIHUVZKHUHDVWKH\DUHELWV ZLGHDQGVSHFLI\E\WHRIIVHWVIRUVLQJOHGDWDWUDQVIHUV 7KHELWXQVLJQHGLPPHGLDWHRIIVHWLVVKLIWHGOHIWELWVDQGHLWKHUDGGHGWR8 RUVXEWUDFWHGIURP8 WKH EDVHUHJLVWHU5QWKLVFDOFXODWLRQPD\EHSHUIRUPHGHLWKHUEHIRUH3 RUDIWHU3 WKHEDVHLVXVHGDVWKH WUDQVIHUDGGUHVV7KHPRGLILHGEDVHYDOXHPD\EHRYHUZULWWHQEDFNLQWRWKHEDVHUHJLVWHULI: RUWKHROGYDOXH RIWKHEDVHPD\EHSUHVHUYHG: 1RWHWKDWSRVWLQGH[HGDGGUHVVLQJPRGHVUHTXLUHH[SOLFLWVHWWLQJRIWKH:ELW XQOLNH/'5DQG675ZKLFKDOZD\VZULWHEDFNZKHQSRVWLQGH[HG 7KHYDOXHRIWKHEDVHUHJLVWHUPRGLILHGE\WKHRIIVHWLQDSUHLQGH[HGLQVWUXFWLRQLVXVHGDVWKHDGGUHVVIRUWKH WUDQVIHURIWKHILUVWZRUG7KHVHFRQGZRUGLIPRUHWKDQRQHLVWUDQVIHUUHGZLOOJRWRRUFRPHIURPDQDGGUHVVRQH ZRUGE\WHVKLJKHUWKDQWKHILUVWWUDQVIHUDQGWKHDGGUHVVZLOOEHLQFUHPHQWHGE\RQHZRUGIRUHDFKVXEVHTXHQW WUDQVIHU $''5(66$/,*10(17 7KHEDVHDGGUHVVVKRXOGQRUPDOO\EHDZRUGDOLJQHGTXDQWLW\7KHERWWRPELWVRIWKHDGGUHVVZLOODSSHDURQ$>@ DQGPLJKWEHLQWHUSUHWHGE\WKHPHPRU\V\VWHP 86(2)5 ,I5QLV5WKHYDOXHXVHGZLOOEHWKHDGGUHVVRIWKHLQVWUXFWLRQSOXVE\WHV%DVHZULWHEDFNWR5PXVWQRWEH VSHFLILHG '$7$$%2576 ,IWKHDGGUHVVLVOHJDOEXWWKHPHPRU\PDQDJHUJHQHUDWHVDQDERUWWKHGDWDWUDSZLOOEHWDNHQ7KHZULWHEDFNRI WKHPRGLILHGEDVHZLOOWDNHSODFHEXWDOORWKHUSURFHVVRUVWDWHZLOOEHSUHVHUYHG7KHFRSURFHVVRULVSDUWO\ UHVSRQVLEOHIRUHQVXULQJWKDWWKHGDWDWUDQVIHUFDQEHUHVWDUWHGDIWHUWKHFDXVHRIWKHDERUWKDVEHHQUHVROYHGDQG PXVWHQVXUHWKDWDQ\VXEVHTXHQWDFWLRQVLWXQGHUWDNHVFDQEHUHSHDWHGZKHQWKHLQVWUXFWLRQLVUHWULHG ,16758&7,21&<&/(7,0(6 &RSURFHVVRUGDWDWUDQVIHULQVWUXFWLRQVWDNHQ61E,LQFUHPHQWDOF\FOHVWRH[HFXWHZKHUH Q E 7KHQXPEHURIZRUGVWUDQVIHUUHG 7KHQXPEHURIF\FOHVVSHQWLQWKHFRSURFHVVRUEXV\ZDLWORRS 61DQG,DUHGHILQHGDVVTXHQWLDO6F\FOHQRQVTXHQWLDO1F\FOHDQGLQWHUQDO,F\FOHUHVSHFWLYHO\ .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 $66(0%/(56<17$; /'&_67&!^FRQG`^/`SFG$GGUHVV! /'& 67& ^/` ^FRQG` S FG $GGUHVV!FDQEH $QH[SUHVVLRQZKLFKJHQHUDWHVDQDGGUHVV 7KHDVVHPEOHUZLOODWWHPSWWRJHQHUDWHDQLQVWUXFWLRQXVLQJWKH3&DVDEDVHDQGD FRUUHFWHGLPPHGLDWHRIIVHWWRDGGUHVVWKHORFDWLRQJLYHQE\HYDOXDWLQJWKHH[SUHVVLRQ 7KLVZLOOEHD3&UHODWLYHSUHLQGH[HGDGGUHVV,IWKHDGGUHVVLVRXWRIUDQJHDQHUURU ZLOOEHJHQHUDWHG $SUHLQGH[HGDGGUHVVLQJVSHFLILFDWLRQ >5Q@ RIIVHWRI]HUR >5QH[SUHVVLRQ!@^` RIIVHWRIH[SUHVVLRQ!E\WHV $SRVWLQGH[HGDGGUHVVLQJVSHFLILFDWLRQ [email protected][SUHVVLRQ RIIVHWRIH[SUHVVLRQ!E\WHV ^` ZULWHEDFNWKHEDVHUHJLVWHUVHWWKH:ELW LILVSUHVHQW 5Q LVDQH[SUHVVLRQHYDOXDWLQJWRDYDOLG $507'0,UHJLVWHUQXPEHU 127( ,I5QLV5WKHDVVHPEOHUZLOOVXEWUDFWIURPWKHRIIVHWYDOXHWRDOORZIRU$507'0,SLSHOLQLQJ (;$03/(6 /'& 67&(4/ SFWDEOH SF>5@ /RDGFRIFRSURFIURPDGGUHVV WDEOHXVLQJD3&UHODWLYHDGGUHVV &RQGLWLRQDOO\VWRUHFRIFRSURF LQWRDQDGGUHVVE\WHVXSIURP5 ZULWHWKLVDGGUHVVEDFNWR5DQGXVH ORQJWUDQVIHURSWLRQSUREDEO\WRVWRUHPXOWLSOHZRUGV /RDGIURPPHPRU\WRFRSURFHVVRU 6WRUHIURPFRSURFHVVRUWRPHPRU\ :KHQSUHVHQWSHUIRUPORQJWUDQVIHU1 RWKHUZLVHSHUIRUPVKRUWWUDQVIHU1 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH 7KHXQLTXHQXPEHURIWKHUHTXLUHGFRSURFHVVRU $QH[SUHVVLRQHYDOXDWLQJWRDYDOLGFRSURFHVVRUUHJLVWHUQXPEHUWKDWLVSODFHGLQWKH &5GILHOG 127( $OWKRXJKWKHDGGUHVVRIIVHWLVH[SUHVVHGLQE\WHVWKHLQVWUXFWLRQRIIVHWILHOGLVLQZRUGV7KHDVVHPEOHUZLOO DGMXVWWKHRIIVHWDSSURSULDWHO\ $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 &2352&(66255(*,67(575$16)(5605&0&5 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQHQFRGLQJLVVKRZQLQ)LJXUH 7KLVFODVVRILQVWUXFWLRQLVXVHGWRFRPPXQLFDWHLQIRUPDWLRQGLUHFWO\EHWZHHQ$507'0,DQGDFRSURFHVVRU$Q H[DPSOHRIDFRSURFHVVRUWR$507'0,UHJLVWHUWUDQVIHU05&LQVWUXFWLRQZRXOGEHD),;RIDIORDWLQJSRLQWYDOXH KHOGLQDFRSURFHVVRUZKHUHWKHIORDWLQJSRLQWQXPEHULVFRQYHUWHGLQWRDELWLQWHJHUZLWKLQWKHFRSURFHVVRUDQG WKHUHVXOWLVWKHQWUDQVIHUUHGWR$507'0,UHJLVWHU$)/2$7RIDELWYDOXHLQ$507'0,UHJLVWHULQWRD IORDWLQJSRLQWYDOXHZLWKLQWKHFRSURFHVVRULOOXVWUDWHVWKHXVHRI$507'0,UHJLVWHUWRFRSURFHVVRUWUDQVIHU0&5 $QLPSRUWDQWXVHRIWKLVLQVWUXFWLRQLVWRFRPPXQLFDWHFRQWUROLQIRUPDWLRQGLUHFWO\IURPWKHFRSURFHVVRULQWRWKH $507'0,&365IODJV$VDQH[DPSOHWKHUHVXOWRIDFRPSDULVRQRIWZRIORDWLQJSRLQWYDOXHVZLWKLQD FRSURFHVVRUFDQEHPRYHGWRWKH&365WRFRQWUROWKHVXEVHTXHQWIORZRIH[HFXWLRQ &RQG &32SF / &5Q 5G &3 &3 &5P >@&RSURFHVVRURSHUDQGUHJLVWHU >@&RSURFHVVRULQIRUPDWLRQ >@&RSURFHVVRUQXPEHU >@$50VRXUFHGHVWLQDWLRQUHJLVWHU >@&RSURFHVVRUVRXUFHGHVWLQDWLRQUHJLVWHU >@/RDG6WRUHELW 6WRUHWR&R3URFHVVRU /RDGIURP&R3URFHVVRU >@&RSURFHVVRURSHUDWLRQPRGH >@&RQGLWLRQILHOG )LJXUH&RSURFHVVSU5HJLVWHU7UDQVIHU,QVWUXFWLRQV 7+(&2352&(6625),(/'6 7KH&3ILHOGLVXVHGDVIRUDOOFRSURFHVVRULQVWUXFWLRQVWRVSHFLI\ZKLFKFRSURFHVVRULVEHLQJFDOOHGXSRQ 7KH&32SF&5Q&3DQG&5PILHOGVDUHXVHGRQO\E\WKHFRSURFHVVRUDQGWKHLQWHUSUHWDWLRQSUHVHQWHGKHUHLV GHULYHGIURPFRQYHQWLRQRQO\2WKHULQWHUSUHWDWLRQVDUHDOORZHGZKHUHWKHFRSURFHVVRUIXQFWLRQDOLW\LVLQFRPSDWLEOH ZLWKWKLVRQH7KHFRQYHQWLRQDOLQWHUSUHWDWLRQLVWKDWWKH&32SFDQG&3ILHOGVVSHFLI\WKHRSHUDWLRQWKH FRSURFHVVRULVUHTXLUHGWRSHUIRUP&5QLVWKHFRSURFHVVRUUHJLVWHUZKLFKLVWKHVRXUFHRUGHVWLQDWLRQRIWKH WUDQVIHUUHGLQIRUPDWLRQDQG&5PLVDVHFRQGFRSURFHVVRUUHJLVWHUZKLFKPD\EHLQYROYHGLQVRPHZD\ZKLFK GHSHQGVRQWKHSDUWLFXODURSHUDWLRQVSHFLILHG .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 75$16)(56725 :KHQDFRSURFHVVRUUHJLVWHUWUDQVIHUWR$507'0,KDV5DVWKHGHVWLQDWLRQELWVDQGRIWKH WUDQVIHUUHGZRUGDUHFRSLHGLQWRWKH1=&DQG9IODJVUHVSHFWLYHO\7KHRWKHUELWVRIWKHWUDQVIHUUHGZRUGDUH LJQRUHGDQGWKH3&DQGRWKHU&365ELWVDUHXQDIIHFWHGE\WKHWUDQVIHU 75$16)(56)5205 $FRSURFHVVRUUHJLVWHUWUDQVIHUIURP$507'0,ZLWK5DVWKHVRXUFHUHJLVWHUZLOOVWRUHWKH3& ,16758&7,21&<&/(7,0(6 05&LQVWUXFWLRQVWDNH6E,&LQFUHPHQWDOF\FOHVWRH[HFXWHZKHUH6,DQG&DUHGHILQHGDVVTXHQWLDO6 F\FOHLQWHUQDO,F\FOHDQGFRSURFHVVRUUHJLVWHUWUDQVIHU&F\FOHUHVSHFWLYHO\0&5LQVWUXFWLRQVWDNH6E, &LQFUHPHQWDOF\FOHVWRH[HFXWHZKHUHELVWKHQXPEHURIF\FOHVVSHQWLQWKHFRSURFHVVRUEXV\ZDLWORRS $66(0%/(56<17$; 0&5_05&!^FRQG`SH[SUHVVLRQ!5GFQFP^H[SUHVVLRQ!` 05& 0&5 ^FRQG` S H[SUHVVLRQ! 5G FQDQGFP H[SUHVVLRQ! (;$03/(6 05& S5FF 5HTXHVWFRSURFWRSHUIRUPRSHUDWLRQ RQFDQGFDQGWUDQVIHUWKHVLQJOH ELWZRUGUHVXOWEDFNWR5 5HTXHVWFRSURFWRSHUIRUPRSHUDWLRQ RQ5DQGSODFHWKHUHVXOWLQF &RQGLWLRQDOO\UHTXHVWFRSURFWR SHUIRUPRSHUDWLRQW\SHRQFDQG FDQGWUDQVIHUWKHUHVXOWEDFNWR5 0RYHIURPFRSURFHVVRUWR$507'0,UHJLVWHU/ 0RYHIURP$507'0,UHJLVWHUWRFRSURFHVVRU/ 7ZRFKDUDFWHUFRQGLWLRQPQHPRQLF6HH7DEOH 7KHXQLTXHQXPEHURIWKHUHTXLUHGFRSURFHVVRU (YDOXDWHGWRDFRQVWDQWDQGSODFHGLQWKH&32SFILHOG $QH[SUHVVLRQHYDOXDWLQJWRDYDOLG$507'0,UHJLVWHUQXPEHU ([SUHVVLRQVHYDOXDWLQJWRWKHYDOLGFRSURFHVVRUUHJLVWHUQXPEHUV&5QDQG&5P UHVSHFWLYHO\ :KHUHSUHVHQWLVHYDOXDWHGWRDFRQVWDQWDQGSODFHGLQWKH&3ILHOG 0&5 05&(4 S5FF S5FF $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 81'(),1(',16758&7,21 7KHLQVWUXFWLRQLVRQO\H[HFXWHGLIWKHFRQGLWLRQLVWUXH7KHYDULRXVFRQGLWLRQVDUHGHILQHGLQ7DEOH7KH LQVWUXFWLRQIRUPDWLVVKRZQLQ)LJXUH &RQG [[[[[[[[[[[[[[[[[[[[ [[[[ )LJXUH8QGHILQHG,QVWUXFWLRQ ,IWKHFRQGLWLRQLVWUXHWKHXQGHILQHGLQVWUXFWLRQWUDSZLOOEHWDNHQ 1RWHWKDWWKHXQGHILQHGLQVWUXFWLRQPHFKDQLVPLQYROYHVRIIHULQJWKLVLQVWUXFWLRQWRDQ\FRSURFHVVRUVZKLFKPD\EH SUHVHQWDQGDOOFRSURFHVVRUVPXVWUHIXVHWRDFFHSWLWE\GULYLQJ&3$DQG&3%+,*+ ,16758&7,21&<&/(7,0(6 7KLVLQVWUXFWLRQWDNHV6,1F\FOHVZKHUH61DQG,DUHGHILQHGDVVTXHQWLDO6F\FOHQRQVHTXHQWLDO1 F\FOHDQGLQWHUQDO,F\FOH $66(0%/(56<17$; 7KHDVVHPEOHUKDVQRPQHPRQLFVIRUJHQHUDWLQJWKLVLQVWUXFWLRQ,ILWLVDGRSWHGLQWKHIXWXUHIRUVRPHVSHFLILHG XVHVXLWDEOHPQHPRQLFVZLOOEHDGGHGWRWKHDVVHPEOHU8QWLOVXFKWLPHWKLVLQVWUXFWLRQPXVWQRWEHXVHG .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 ,16758&7,216(7(;$03/(6 7KHIROORZLQJH[DPSOHVVKRZZD\VLQZKLFKWKHEDVLF$507'0,LQVWUXFWLRQVFDQFRPELQHWRJLYHHIILFLHQWFRGH 1RQHRIWKHVHPHWKRGVVDYHVDJUHDWGHDORIH[HFXWLRQWLPHDOWKRXJKWKH\PD\VDYHVRPHPRVWO\WKH\MXVWVDYH FRGH 86,1*7+(&21',7,21$/,16758&7,216 8VLQJ&RQGLWLRQDOVIRU/RJLFDO25 &03 %(4 &03 %(4 7KLVFDQEHUHSODFHGE\ &03 &031( %(4 $EVROXWH9DOXH 7(4 56%0, 5Q 5Q5Q 7HVWVLJQ DQGVFRPSOHPHQWLIQHFHVVDU\ 5QS 5PT /DEHO ,IFRQGLWLRQQRWVDWLVILHGWU\RWKHUWHVW 5QS /DEHO 5PT /DEHO ,I5Q S255P T7+(1*272/DEHO 0XOWLSOLFDWLRQE\RU5XQ7LPH 029 &03 $''&6 $''+, 5F5D/6/ 5E 5F5F5D 5F5F5D 0XOWLSO\E\ 7HVWYDOXH &RPSOHWHPXOWLSO\E\ &RPSOHWHPXOWLSO\E\ &RPELQLQJ'LVFUHWHDQG5DQJH7HVWV 7(4 &031( 029/6 5F 5F 5F 'LVFUHWHWHVW 5DQJHWHVW ,)5F 255F $6&,, 7+(15F $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 'LYLVLRQDQG5HPDLQGHU $QXPEHURIGLYLGHURXWLQHVIRUVSHFLILFDSSOLFDWLRQVDUHSURYLGHGLQVRXUFHIRUPDVSDUWRIWKH$16,&OLEUDU\ SURYLGHGZLWKWKH$50&URVV'HYHORSPHQW7RRONLWDYDLODEOHIURP\RXUVXSSOLHU$VKRUWJHQHUDOSXUSRVHGLYLGH URXWLQHIROORZV 029 &03 &03&& 029&& 029&& %&& 029 &03 68%&6 $''&6 0296 0291( %1( 5FQW 5E[ 5E5D 5E5E$6/ 5FQW5FQW$6/ 'LY 5F 5D5E 5D5D5E 5F5F5FQW 5FQW5FQW/65 5E5E/65 'LY (QWHUZLWKQXPEHUVLQ5DDQG5E %LWWRFRQWUROWKHGLYLVLRQ 0RYH5EXQWLOJUHDWHUWKDQ5D 'LY 'LY 7HVWIRUSRVVLEOHVXEWUDFWLRQ 6XEWUDFWLIRN 3XWUHOHYDQWELWLQWRUHVXOW 6KLIWFRQWUROELW +DOYHXQOHVVILQLVKHG 'LYLGHUHVXOWLQ5FUHPDLQGHULQ5D 2YHUIORZ(HWHFWLRQLQWKH$507'0, 2YHUIORZLQXQVLJQHGPXOWLSO\ZLWKDELWUHVXOW 808// 5G5W5P5Q WRF\FOHV 7(4 5W F\FOHDQGDUHJLVWHU %1( RYHUIORZ 2YHUIORZLQVLJQHGPXOWLSO\ZLWKDELWUHVXOW 608// 7(4 %1( 5G5W5P5Q 5W5G$65 RYHUIORZ WRF\FOHV F\FOHDQGDUHJLVWHU 2YHUIORZLQXQVLJQHGPXOWLSO\DFFXPXODWHZLWKDELWUHVXOW 80/$/ 7(4 %1( 5G5W5P5Q 5W RYHUIORZ WRF\FOHV F\FOHDQGDUHJLVWHU 2YHUIORZLQVLJQHGPXOWLSO\DFFXPXODWHZLWKDELWUHVXOW 60/$/ 7(4 %1( 5G5W5P5Q 5W5G$65 RYHUIORZ WRF\FOHV F\FOHDQGDUHJLVWHU .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 2YHUIORZLQXQVLJQHGPXOWLSO\DFFXPXODWHZLWKDELWUHVXOW 808// $''6 $'& %&6 5O5K5P5Q 5O5O5D 5K5K5D RYHUIORZ WRF\FOHV /RZHUDFFXPXODWH 8SSHUDFFXPXODWH F\FOHDQGUHJLVWHUV 2YHUIORZLQVLJQHGPXOWLSO\DFFXPXODWHZLWKDELWUHVXOW 608// $''6 $'& %96 5O5K5P5Q 5O5O5D 5K5K5D RYHUIORZ WRF\FOHV /RZHUDFFXPXODWH 8SSHUDFFXPXODWH F\FOHDQGUHJLVWHUV 127( 2YHUIORZFKHFNLQJLVQRWDSSOLFDEOHWRXQVLJQHGDQGVLJQHGPXOWLSOLHVZLWKDELWUHVXOWVLQFHRYHUIORZ GRHVQRWRFFXULQVXFKFDOFXODWLRQV 36(8'25$1'20%,1$5<6(48(1&(*(1(5$725 ,WLVRIWHQQHFHVVDU\WRJHQHUDWHSVHXGRUDQGRPQXPEHUVDQGWKHPRVWHIILFLHQWDOJRULWKPVDUHEDVHGRQVKLIW JHQHUDWRUVZLWKH[FOXVLYH25IHHGEDFNUDWKHUOLNHDF\FOLFUHGXQGDQF\FKHFNJHQHUDWRU8QIRUWXQDWHO\WKH VHTXHQFHRIDELWJHQHUDWRUQHHGVPRUHWKDQRQHIHHGEDFNWDSWREHPD[LPDOOHQJWKLHAF\FOHVEHIRUH UHSHWLWLRQVRWKLVH[DPSOHXVHVDELWUHJLVWHUZLWKWDSVDWELWVDQG7KHEDVLFDOJRULWKPLVQHZELW ELW HRUELWVKLIWOHIWWKHELWQXPEHUDQGSXWLQQHZELWDWWKHERWWRPWKLVRSHUDWLRQLVSHUIRUPHGIRUDOOWKHQHZELWV QHHGHGLHELWV7KHHQWLUHRSHUDWLRQFDQEHGRQHLQ6F\FOHV (QWHUZLWKVHHGLQ5DELWV 5EELWLQ5EOVEXVHV5F 7RSELWLQWRFDUU\ ELWURWDWHULJKW &DUU\LQWROVERI5E LQYROYHG VLPLODUO\LQYROYHGQHZVHHGLQ5D5EDVEHIRUH 767 0296 $'& (25 (25 5E5E/65 5F5D55; 5E5E5E 5F5F5D/6/ 5D5F5F/65 08/7,3/,&$7,21%<&2167$1786,1*7+(%$55(/6+,)7(5 0XOWLSOLFDWLRQE\AQ 029 5D5E/6/Q 0XOWLSOLFDWLRQE\AQ $'' 5D5D5D/6/Q 0XOWLSOLFDWLRQE\AQ 56% 5D5D5D/6/Q $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 0XOWLSOLFDWLRQE\ $'' 029 5D5D5D/6/ 5D5D/6/ 0XOWLSO\E\ DQGWKHQE\ 0XOWLSO\E\DQGDGGLQH[WUDQXPEHU $'' 5D5D5D/6/ $'' 5D5F5D/6/ 0XOWLSO\E\ 0XOWLSO\E\DQGDGGLQQH[WGLJLW *HQHUDOUHFXUVLYHPHWKRGIRU5E 5D&&DFRQVWDQW ,I&HYHQVD\& AQ''RGG ' '! 029 0295E5D/6/Q ^5E 5D'` 5E5E/6/Q ,I&02' VD\& AQ''RGGQ! ' '! $'' $''5E5D5D/6/Q ^5E 5D'` 5E5D5E/6/Q ,I&02' VD\& AQ''RGGQ! ' '! 56% 56%5E5D5D/6/Q ^5E 5D'` 5E5D5E/6/Q 7KLVLVQRWTXLWHRSWLPDOEXWFORVH$QH[DPSOHRILWVQRQRSWLPDOLW\LVPXOWLSO\E\ZKLFKLVGRQHE\ 56% 56% $'' UDWKHUWKDQE\ $'' $'' 5E5D5D/6/ 5E5E5E/6/ 0XOWLSO\E\ 0XOWLSO\E\ 5E5D5D/6/ 5E5D5E/6/ 5E5D5E/6/ 0XOWLSO\E\ 0XOWLSO\E\ 0XOWLSO\E\ .6&5,6&0,&52&21752//(5 $50,16758&7,216(7 /2$',1*$:25')520$181.12:1$/,*10(17 (QWHUZLWKDGGUHVVLQ5DELWVXVHV 5E5FUHVXOWLQ5G1RWHGPXVWEHOHVVWKDQFHJ *HWZRUGDOLJQHGDGGUHVV *HWELWVFRQWDLQLQJDQVZHU &RUUHFWLRQIDFWRULQE\WHV QRZLQELWVDQGWHVWLIDOLJQHG 3URGXFHERWWRPRIUHVXOWZRUGLIQRWDOLJQHG *HWRWKHUVKLIWDPRXQW &RPELQHWZRKDOYHVWRJHWUHVXOW %,& /'0,$ $1' 0296 0291( 56%1( 2551( 5E5D 5E^5G5F` 5E5D 5E5E/6/ 5G5G/655E 5E5E 5G5G5F/6/5E $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 7+80%,16758&7,216(7)250$7 7KHWKXPELQVWUXFWLRQVHWVDUHELWYHUVLRQVRI$50LQVWUXFWLRQVHWVELWIRUPDW7KH$50LQVWUXFWLRQVDUH UHGXFHGWRELWYHUVLRQV7KXPELQVWUXFWLRQVDWWKHFRVWRIYHUVDWLOHIXQFWLRQVRIWKH$50LQVWUXFWLRQVHWV7KH WKXPELQVWUXFWLRQVDUHGHFRPSUHVVHGWRWKH$50LQVWUXFWLRQVE\WKH7KXPEGHFRPSUHVVRULQVLGHWKH$507'0, FRUH $VWKH7KXPELQVWUXFWLRQVDUHFRPSUHVVHG$50LQVWUXFWLRQVWKH7KXPELQVWUXFWLRQVKDYHWKHELWIRUPDW LQVWUXFWLRQVDQGKDYHVRPHUHVWULFWLRQV7KHUHVWULFWLRQVE\ELWIRUPDWLVIXOO\QRWLILHGIRUXVLQJWKH7KXPE LQVWUXFWLRQV )250$76800$5< 7KH7+80%LQVWUXFWLRQVHWIRUPDWVDUHVKRZQLQWKHIROORZLQJILJXUH 2S 2S % 2IIVHW , 2S 5QRIIVHW 5G / % 6 2S 5G 5R 5R 2IIVHW 2IIVHW 5G 5G 5E &RQG 5 6 2S + + 5V 5V 2IIVHW 5V 5V+V :RUG 5E 5E 5E 5E :RUG :RUG 6:RUG 5OLVW 5OLVW 6RIIVHW 9DOXH 2IIVHW 2IIVHW 5G 5G 0RYHVKLIWHGUHJLVWHU $GGVXEWUDFW 0RYHFRPSDUHDGG VXEWUDFWLPPHGLDWH 5G 5G+G $/8RSHUDWLRQV +LUHJLVWHURSHUDWLRQV EUDQFKH[FKDQJH 3&UHODWLYHORDG 5G 5G 5G 5G /RDGVWRUHZLWKUHJLVWHU RIIVHW /RDGVWRUHVLJQH[WHQGHG E\WHKDOIZRUG /RDGVWRUHZLWKLPPHGLDWH RIIVHW /RDGVWRUHKDOIZRUG 63UHODWLYHORDGVWRUH /RDGDGGUHVV $GGRIIVHWWRVWDFNSRLQWHU 3XVKSRSUHJLVWHUV 0XOWLSOHORDGVWRUH &RQGLWLRQDOEUDQFK 6RIWZDUH,QWHUUXSW 8QFRQGLWLRQDOEUDQFK /RQJEUDQFKZLWKOLQN + / / / 63 / / + )LJXUH7+80%,QVWUXFWLRQ6HW)RUPDWV 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 23&2'(6800$5< 7KHIROORZLQJWDEOHVXPPDUL]HVWKH7+80%LQVWUXFWLRQVHW)RUIXUWKHULQIRUPDWLRQDERXWDSDUWLFXODULQVWUXFWLRQ SOHDVHUHIHUWRWKHVHFWLRQVOLVWHGLQWKHULJKWPRVWFROXPQ 7DEOH7+80%,QVWUXFWLRQ6HW2SFRGHV 0QHPRQLF $'& $'' $1' $65 % %[[ %,& %/ %; &01 &03 (25 /'0,$ /'5 /'5% /'5+ /6/ /'6% /'6+ /65 029 08/ 091 1(* 255 ,QVWUXFWLRQ $GGZLWK&DUU\ $GG $1' $ULWKPHWLF6KLIW 5LJKW 8QFRQGLWLRQDO EUDQFK &RQGLWLRQDOEUDQFK %LW&OHDU %UDQFKDQG/LQN %UDQFKDQG ([FKDQJH &RPSDUH1HJDWLYH &RPSDUH (25 /RDGPXOWLSOH /RDGZRUG /RDGE\WH /RDGKDOIZRUG /RJLFDO6KLIW/HIW /RDGVLJQH[WHQGHG E\WH /RDGVLJQH[WHQGHG KDOIZRUG /RJLFDO6KLIW5LJKW 0RYHUHJLVWHU 0XOWLSO\ 0RYH1HJDWLYH UHJLVWHU 1HJDWH 25 /R5HJLVWHU +L5HJLVWHU &RQGLWLRQ 2SHUDQG 2SHUDQG &RGHV6HW 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 7DEOH7+80%,QVWUXFWLRQ6HW2SFRGHV&RQWLQXHG 0QHPRQLF 323 386+ 525 6%& 670,$ 675 675% 675+ 6:, 68% 767 ,QVWUXFWLRQ 3RSUHJLVWHUV 3XVKUHJLVWHUV 5RWDWH5LJKW 6XEWUDFWZLWK&DUU\ 6WRUH0XOWLSOH 6WRUHZRUG 6WRUHE\WH 6WRUHKDOIZRUG 6RIWZDUH,QWHUUXSW 6XEWUDFW 7HVWELWV /R5HJLVWHU +L5HJLVWHU &RQGLWLRQ 2SHUDQG 2SHUDQG &RGHV6HW 9 9 9 9 9 9 9 9 9 9 9 9 9 9 127(6 7KHFRQGLWLRQFRGHVDUHXQDIIHFWHGE\WKHIRUPDWDQGYHUVLRQVRIWKLVLQVWUXFWLRQ 7KHFRQGLWLRQFRGHVDUHXQDIIHFWHGE\WKHIRUPDWYHUVLRQRIWKLVLQVWUXFWLRQ 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 )250$7029(6+,)7('5(*,67(5 2S 2IIVHW 5V 5G >@'HVWLQDWLRQUHJLVWHU >@6RXUFHUHJLVWHU >@,PPHGLDWHYDOXH >@2SFRGH /6/ /65 $65 )LJXUH)RUPDW 23(5$7,21 7KHVHLQVWUXFWLRQVPRYHDVKLIWHGYDOXHEHWZHHQ/RUHJLVWHUV7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQ 7DEOH 127( $OOLQVWUXFWLRQVLQWKLVJURXSVHWWKH&365FRQGLWLRQFRGHV 7DEOH6XPPDU\RI)RUPDW,QVWUXFWLRQV 23 7+80%DVVHPEOHU /6/5G5V2IIVHW /655G5V2IIVHW $50HTXLYDOHQW 02965G5V/6/ 2IIVHW 02965G5V/65 2IIVHW $FWLRQ 6KLIW5VOHIWE\DELWLPPHGLDWH YDOXHDQGVWRUHWKHUHVXOWLQ5G 3HUIRUPORJLFDOVKLIWULJKWRQ5VE\D ELWLPPHGLDWHYDOXHDQGVWRUHWKH UHVXOWLQ5G 3HUIRUPDULWKPHWLFVKLIWULJKWRQ5V E\DELWLPPHGLDWHYDOXHDQGVWRUH WKHUHVXOWLQ5G $655G5V2IIVHW 02965G5V$65 2IIVHW .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOHWLPHV IRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 /65 55 /RJLFDOVKLIWULJKWWKHFRQWHQWV RI5E\DQGVWRUHWKHUHVXOWLQ5 6HWFRQGLWLRQFRGHVRQWKHUHVXOW 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 )250$7$''68%75$&7 , 2S 5Q2IIVHW 5V 5G >@'HVWLQDWLRQUHJLVWHU >@6RXUFHUHJLVWHU >@5HJLVWHU,PPHGLDWHYDOXH >@2SFRGH $GG 68% >@,PPHGLDWHIODJ 5HJLVWHURSHUDQG ,PPHGLDWHRSHUDQG )LJXUH)RUPDW 23(5$7,21 7KHVHLQVWUXFWLRQVDOORZWKHFRQWHQWVRID/RUHJLVWHURUDELWLPPHGLDWHYDOXHWREHDGGHGWRRUVXEWUDFWHGIURP D/RUHJLVWHU7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQ7DEOH 127( $OOLQVWUXFWLRQVLQWKLVJURXSVHWWKH&365FRQGLWLRQFRGHV 7DEOH6XPPDU\RI)RUPDW,QVWUXFWLRQV 2S , 7+80%DVVHPEOHU $''5G5V5Q $50HTXLYDOHQW $''65G5V5Q $FWLRQ $GGFRQWHQWVRI5QWRFRQWHQWVRI5V 3ODFHUHVXOWLQ5G $GGELWLPPHGLDWHYDOXHWRFRQWHQWVRI 5V3ODFHUHVXOWLQ5G 6XEWUDFWFRQWHQWVRI5QIURPFRQWHQWVRI 5V3ODFHUHVXOWLQ5G 6XEWUDFWELWLPPHGLDWHYDOXHIURP FRQWHQWVRI5V3ODFHUHVXOWLQ5G $''5G5V2IIVHW $''65G5V 2IIVHW 68%5G5V5Q 68%65G5V5Q 68%5G5V2IIVHW 68%65G5V 2IIVHW .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOHWLPHV IRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 $'' 68% 555 55 5 55DQGVHWFRQGLWLRQFRGHVRQWKHUHVXOW 5 5DQGVHWFRQGLWLRQFRGHV 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 )250$7029(&203$5($''68%75$&7,00(',$7( 2S 5G 2IIVHW >@,PPHGLDWHYDOXH >@6RXUFH'HVWLQDWLRQUHJLVWHU >@2SFRGH 029 &03 $'' 68% )LJXUH)RUPDW 23(5$7,216 7KHLQVWUXFWLRQVLQWKLVJURXSSHUIRUPRSHUDWLRQVEHWZHHQD/RUHJLVWHUDQGDQELWLPPHGLDWHYDOXH7KH7+80% DVVHPEOHUV\QWD[LVVKRZQLQ7DEOH 127( $OOLQVWUXFWLRQVLQWKLVJURXSVHWWKH&365FRQGLWLRQFRGHV 7DEOH6XPPDU\RI)RUPDW,QVWUXFWLRQV 2S 7+80%DVVHPEOHU 0295G2IIVHW &035G2IIVHW $''5G2IIVHW 68%5G2IIVHW $50HTXLYDOHQW 02965G2IIVHW &035G2IIVHW $''65G5G 2IIVHW 68%65G5G 2IIVHW $FWLRQ 0RYHELWLPPHGLDWHYDOXHLQWR5G &RPSDUHFRQWHQWVRI5GZLWKELW LPPHGLDWHYDOXH $GGELWLPPHGLDWHYDOXHWRFRQWHQWVRI 5GDQGSODFHWKHUHVXOWLQ5G 6XEWUDFWELWLPPHGLDWHYDOXHIURP FRQWHQWVRI5GDQGSODFHWKHUHVXOWLQ 5G .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 029 &03 $'' 68% 5 5 5 5 5 DQGVHWFRQGLWLRQFRGHV 6HWFRQGLWLRQFRGHVRQ5 5 5DQGVHWFRQGLWLRQFRGHV 5 5DQGVHWFRQGLWLRQFRGHV 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 )250$7$/823(5$7,216 2S 5V 5G >@6RXUFH'HVWLQDWLRQUHJLVWHU >@6RXUFHUHJLVWHU >@2SFRGH )LJXUH)RUPDW 23(5$7,21 7KHIROORZLQJLQVWUXFWLRQVSHUIRUP$/8RSHUDWLRQVRQD/RUHJLVWHUSDLU 127( $OOLQVWUXFWLRQVLQWKLVJURXSVHWWKH&365FRQGLWLRQFRGHV 7DEOH6XPPDU\RI)RUPDW,QVWUXFWLRQV 23 7+80%DVVHPEOHU $1'5G5V (255G5V /6/5G5V /655G5V $655G5V $'&5G5V 6%&5G5V 5255G5V 7675G5V 1(*5G5V &035G5V &015G5V 2555G5V 08/5G5V %,&5G5V 0915G5V $50HTXLYDOHQW $1'65G5G5V (2565G5G5V 02965G5G/6/5V 02965G5G/655V 02965G5G$655V $'&65G5G5V 6%&65G5G5V 02965G5G5255V 7675G5V 56%65G5V &035G5V &015G5V 25565G5G5V 08/65G5V5G %,&65G5G5V 09165G5V $FWLRQ 5G 5G$1'5V 5G 5G(255V 5G 5G5V 5G 5G!!5V 5G 5G$655V 5G 5G5V&ELW 5G 5G5V127&ELW 5G 5G5255V 6HWFRQGLWLRQFRGHVRQ5G$1'5V 5G 5V 6HWFRQGLWLRQFRGHVRQ5G5V 6HWFRQGLWLRQFRGHVRQ5G5V 5G 5G255V 5G 5V5G 5G 5G$1'1275V 5G 1275V .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 (25 525 1(* &03 08/ 55 55 55 55 55 5 5(255DQGVHWFRQGLWLRQFRGHV 5RWDWH5LJKW5E\WKHYDOXHLQ5VWRUH WKHUHVXOWLQ5DQGVHWFRQGLWLRQFRGHV 6XEWUDFWWKHFRQWHQWVRI5IURP]HUR VWRUHWKHUHVXOWLQ56HWFRQGLWLRQFRGHVLH5 5 6HWWKHFRQGLWLRQFRGHVRQWKHUHVXOWRI55 5 55DQGVHWFRQGLWLRQFRGHV 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 )250$7+,5(*,67(523(5$7,216%5$1&+(;&+$1*( 2S + + 5V+V 5G+G >@'HVWLQDWLRQUHJLVWHU >@6RXUFHUHJLVWHU >@+LRSHUDQGIODJ >@+LRSHUDQGIODJ >@2SFRGH )LJXUH)RUPDW 23(5$7,21 7KHUHDUHIRXUVHWVRILQVWUXFWLRQVLQWKLVJURXS7KHILUVWWKUHHDOORZ$''&03DQG029RSHUDWLRQVWREH SHUIRUPHGEHWZHHQ/RDQG+LUHJLVWHUVRUDSDLURI+LUHJLVWHUV7KHIRXUWK%;DOORZVD%UDQFKWREHSHUIRUPHG ZKLFKPD\DOVREHXVHGWRVZLWFKSURFHVVRUVWDWH7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQ7DEOH 127( ,QWKLVJURXSRQO\&032S VHWVWKH&365FRQGLWLRQFRGHV 7KHDFWLRQRI+ + IRU2S $''2S &03DQG2S 029LVXQGHILQHGDQGVKRXOGQRWEH XVHG 7DEOH6XPPDU\RI)RUPDW,QVWUXFWLRQV 2S + + 7+80%DVVHPEOHU $''5G+V $''+G5V $''+G+V &035G+V $50HTXLYDOHQW $''5G5G+V $''+G+G5V $''+G+G+V &035G+V $FWLRQ $GGDUHJLVWHULQWKHUDQJHWRD UHJLVWHULQWKHUDQJH $GGDUHJLVWHULQWKHUDQJHWRD UHJLVWHULQWKHUDQJH $GGWZRUHJLVWHUVLQWKHUDQJH &RPSDUHDUHJLVWHULQWKHUDQJH ZLWKDUHJLVWHULQWKHUDQJH6HW WKHFRQGLWLRQFRGHIODJVRQWKH UHVXOW &RPSDUHDUHJLVWHULQWKHUDQJH ZLWKDUHJLVWHULQWKHUDQJH 6HWWKHFRQGLWLRQFRGHIODJVRQWKH UHVXOW &03+G5V &03+G5V .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 7DEOH6XPPDU\RI)RUPDW,QVWUXFWLRQV&RQWLQXHG 2S + + 7+80%DVVHPEOHU &03+G+V $50HTXLYDOHQW &03+G+V $FWLRQ &RPSDUHWZRUHJLVWHUVLQWKHUDQJH 6HWWKHFRQGLWLRQFRGHIODJVRQ WKHUHVXOW 0RYHDYDOXHIURPDUHJLVWHULQWKH UDQJHWRDUHJLVWHULQWKHUDQJH 0RYHDYDOXHIURPDUHJLVWHULQWKH UDQJHWRDUHJLVWHULQWKHUDQJH 0RYHDYDOXHEHWZHHQWZRUHJLVWHUV LQWKHUDQJH 3HUIRUPEUDQFKSOXVRSWLRQDOVWDWH FKDQJHWRDGGUHVVLQDUHJLVWHULQ WKHUDQJH 3HUIRUPEUDQFKSOXVRSWLRQDOVWDWH FKDQJHWRDGGUHVVLQDUHJLVWHULQ WKHUDQJH 0295G+V 0295G+V 029+G5V 029+G5V 029+G+V %;5V 029+G+V %;5V %;+V %;+V ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ 7+(%;,16758&7,21 %;SHUIRUPVD%UDQFKWRDURXWLQHZKRVHVWDUWDGGUHVVLVVSHFLILHGLQD/RRU+LUHJLVWHU %LWRIWKHDGGUHVVGHWHUPLQHVWKHSURFHVVRUVWDWHRQHQWU\WRWKHURXWLQH %LW %LW &DXVHVWKHSURFHVVRUWRHQWHU$50VWDWH &DXVHVWKHSURFHVVRUWRHQWHU7+80%VWDWH 127( 7KHDFWLRQRI+ IRUWKLVLQVWUXFWLRQLVXQGHILQHGDQGVKRXOGQRWEHXVHG 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 (;$03/(6 +L5HJLVWHU2SHUDWLRQV $'' &03 029 3&5 55 55 3& 3&5EXWGRQWVHWWKHFRQGLWLRQFRGHV 6HWWKHFRQGLWLRQFRGHVRQWKHUHVXOWRI55 0RYH5/5LQWR53& EXWGRQWVHWWKHFRQGLWLRQFRGHV HJUHWXUQIURPVXEURXWLQH %UDQFKDQG([FKDQJH $'5 029 %; 5RXWRI7+80% 55 5 6ZLWFKIURP7+80%WR$50VWDWH /RDGDGGUHVVRIRXWRI7+80%LQWR5 7UDQVIHUWKHFRQWHQWVRI5LQWRWKH3& %LWRI5GHWHUPLQHVZKHWKHU $50RU7+80%VWDWHLVHQWHUHGLH$50VWDWHKHUH $/,*1 &2'( RXWRI7+80% 1RZSURFHVVLQJ$50LQVWUXFWLRQV 86,1*5$6$123(5$1' ,I5LVXVHGDVDQRSHUDQGWKHYDOXHZLOOEHWKHDGGUHVVRIWKHLQVWUXFWLRQZLWKELWFOHDUHG([HFXWLQJD%; 3&LQ7+80%VWDWHIURPDQRQZRUGDOLJQHGDGGUHVVZLOOUHVXOWLQXQSUHGLFWDEOHH[HFXWLRQ .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$73&5(/$7,9(/2$' 5G :RUG >@,PPHGLDWHYDOXH >@'HVWLQDWLRQUHJLVWHU )LJXUH)RUPDW 23(5$7,21 7KLVLQVWUXFWLRQORDGVDZRUGIURPDQDGGUHVVVSHFLILHGDVDELWLPPHGLDWHRIIVHWIURPWKH3&7KH7+80% DVVHPEOHUV\QWD[LVVKRZQEHORZ 7DEOH6XPPDU\RI3&5HODWLYH/RDG,QVWUXFWLRQ 7+80%DVVHPEOHU /'55G>3&,PP@ $50HTXLYDOHQW /'55G>5,PP@ $FWLRQ $GGXQVLJQHGRIIVHW ZRUGVE\WHVLQ,PPWR WKHFXUUHQWYDOXHRIWKH3& /RDGWKHZRUGIURPWKHUHVXOWLQJ DGGUHVVLQWR5G 127( 7KHYDOXHVSHFLILHGE\,PPLVDIXOOELWDGGUHVVEXWPXVWDOZD\VEHZRUGDOLJQHGLHZLWKELWVVHWWR VLQFHWKHDVVHPEOHUSODFHV,PP!!LQILHOG:RUG7KHYDOXHRIWKH3&ZLOOEHE\WHVJUHDWHUWKDQ WKHDGGUHVVRIWKLVLQVWUXFWLRQEXWELWRIWKH3&LVIRUFHGWRWRHQVXUHLWLVZRUGDOLJQHG 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQ7KHLQVWUXFWLRQF\FOHWLPHVIRUWKH7+80% LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 /'55>3&@ /RDGLQWR5WKHZRUGIRXQGDWWKH DGGUHVVIRUPHGE\DGGLQJWR3& ELW>@RI3&LVIRUFHGWR]HUR 1RWHWKDWWKH7+80%RSFRGHZLOOFRQWDLQ DVWKH:RUGYDOXH .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$7/2$'6725(:,7+5(*,67(52))6(7 / % 5R 5E 5G >@6RXUFH'HVWLQDWLRQUHJLVWHU >@%DVHUHJLVWHU >@2IIVHWUHJLVWHU >@%\WH:RUGIODJ 7UDQVIHUZRUGTXDQWLW\ 7UDQVIHUE\WHTXDQWLW\ >@/RDG6WRUHIODJ 6WRUHWRPHPRU\ /RDGIURPPHPRU\ )LJXUH)RUPDW 23(5$7,21 7KHVHLQVWUXFWLRQVWUDQVIHUE\WHRUZRUGYDOXHVEHWZHHQUHJLVWHUVDQGPHPRU\0HPRU\DGGUHVVHVDUHSUH LQGH[HGXVLQJDQRIIVHWUHJLVWHULQWKHUDQJH7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQ7DEOH 7DEOH6XPPDU\RI)RUPDW,QVWUXFWLRQV / % 7+80%DVVHPEOHU 6755G>5E5R@ $50HTXLYDOHQW 6755G>5E5R@ $FWLRQ 3UHLQGH[HGZRUGVWRUH &DOFXODWHWKHWDUJHWDGGUHVVE\ DGGLQJWRJHWKHUWKHYDOXHLQ5E DQGWKHYDOXHLQ5R6WRUHWKH FRQWHQWVRI5GDWWKHDGGUHVV 3UHLQGH[HGE\WHVWRUH &DOFXODWHWKHWDUJHWDGGUHVVE\ DGGLQJWRJHWKHUWKHYDOXHLQ5E DQGWKHYDOXHLQ5R6WRUHWKH E\WHYDOXHLQ5GDWWKHUHVXOWLQJ DGGUHVV 3UHLQGH[HGZRUGORDG &DOFXODWHWKHVRXUFHDGGUHVVE\ DGGLQJWRJHWKHUWKHYDOXHLQ5E DQGWKHYDOXHLQ5R/RDGWKH FRQWHQWVRIWKHDGGUHVVLQWR5G 675%5G>5E5R@ 675%5G>5E5R@ /'55G>5E5R@ /'55G>5E5R@ 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 7DEOH6XPPDU\RI)RUPDW,QVWUXFWLRQV&RQWLQXHG / % 7+80%DVVHPEOHU /'5%5G>5E5R@ $50HTXLYDOHQW /'5%5G>5E5R@ $FWLRQ 3UHLQGH[HGE\WHORDG &DOFXODWHWKHVRXUFHDGGUHVVE\ DGGLQJWRJHWKHUWKHYDOXHLQ5E DQGWKHYDOXHLQ5R/RDGWKH E\WHYDOXHDWWKHUHVXOWLQJ DGGUHVV ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 675 /'5% 5>55@ 5>55@ 6WRUHZRUGLQ5DWWKHDGGUHVV IRUPHGE\DGGLQJ5WR5 /RDGLQWR5WKHE\WHIRXQGDW WKHDGGUHVVIRUPHGE\DGGLQJ5WR5 .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$7/2$'6725(6,*1(;7(1'('%<7(+$/):25' + 6 5R 5E 5G >@'HVWLQDWLRQUHJLVWHU >@%DVHUHJLVWHU >@2IIVHWUHJLVWHU >@6LJQH[WHQGHGIODJ 2SHUDQGQRWVLJQH[WHQGHG 2SHUDQGVLJQH[WHQGHG >@+IODJ )LJXUH)RUPDW 23(5$7,21 7KHVHLQVWUXFWLRQVORDGRSWLRQDOO\VLJQH[WHQGHGE\WHVRUKDOIZRUGVDQGVWRUHKDOIZRUGV7KH7+80%DVVHPEOHU V\QWD[LVVKRZQEHORZ 7DEOH6XPPDU\RIIRUPDWLQVWUXFWLRQV 6 + 7+80%DVVHPEOHU 675+5G>5E5R@ $50HTXLYDOHQW 675+5G>5E5R@ $FWLRQ 6WRUHKDOIZRUG $GG5RWREDVHDGGUHVVLQ5E6WRUH ELWVRI5GDWWKHUHVXOWLQJDGGUHVV /RDGKDOIZRUG $GG5RWREDVHDGGUHVVLQ5E/RDGELWV RI5GIURPWKHUHVXOWLQJDGGUHVV DQGVHWELWVRI5GWR /RDGVLJQH[WHQGHGE\WH $GG5RWREDVHDGGUHVVLQ5E/RDGELWV RI5GIURPWKHUHVXOWLQJDGGUHVV DQGVHWELWVRI5GWRELW /RDGVLJQH[WHQGHGKDOIZRUG $GG5RWREDVHDGGUHVVLQ5E/RDGELWV RI5GIURPWKHUHVXOWLQJDGGUHVV DQGVHWELWVRI5GWRELW /'5+5G>5E5R@ /'5+5G>5E5R@ /'6%5G>5E5R@ /'56%5G>5E5R@ /'6+5G>5E5R@ /'56+5G>5E5R@ 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 675+ /'6% /'6+ 5>55@ 5>55@ 5>55@ 6WRUHWKHORZHUELWVRI5DWWKH DGGUHVVIRUPHGE\DGGLQJ5WR5 /RDGLQWR5WKHVLJQH[WHQGHGE\WH IRXQGDWWKHDGGUHVVIRUPHGE\DGGLQJ5WR5 /RDGLQWR5WKHVLJQH[WHQGHGKDOIZRUG IRXQGDWWKHDGGUHVVIRUPHGE\DGGLQJ5WR5 .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$7/2$'6725(:,7+,00(',$7(2))6(7 % / 2IIVHW 5E 5G >@6RXUFH'HVWLQDWLRQUHJLVWHU >@%DVHUHJLVWHU >@2IIVHWYDOXH >@/RDG6WRUHIODJ 6WRUHWRPHPRU\ /RDGIURPPRPRU\ >@%\WH:RUGIODJ 7UDQVIHUZRUGTXDQWLW\ 7UDQVIHUE\WHTXDQWLW\ )LJXUH)RUPDW 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 23(5$7,21 7KHVHLQVWUXFWLRQVWUDQVIHUE\WHRUZRUGYDOXHVEHWZHHQUHJLVWHUVDQGPHPRU\XVLQJDQLPPHGLDWHRUELWRIIVHW7KH7+80% DVVHPEOHUV\QWD[LVVKRZQLQ7DEOH 7DEOH6XPPDU\RI)RUPDW,QVWUXFWLRQV / % 7+80%DVVHPEOHU 6755G>5E,PP@ $50HTXLYDOHQW 6755G>5E,PP@ $FWLRQ &DOFXODWHWKHWDUJHWDGGUHVVE\ DGGLQJWRJHWKHUWKHYDOXHLQ5E DQG,PP6WRUHWKHFRQWHQWVRI 5GDWWKHDGGUHVV &DOFXODWHWKHVRXUFHDGGUHVVE\ DGGLQJWRJHWKHUWKHYDOXHLQ5E DQG,PP/RDG5GIURPWKH DGGUHVV &DOFXODWHWKHWDUJHWDGGUHVVE\ DGGLQJWRJHWKHUWKHYDOXHLQ5E DQG,PP6WRUHWKHE\WHYDOXH LQ5GDWWKHDGGUHVV &DOFXODWHVRXUFHDGGUHVVE\ DGGLQJWRJHWKHUWKHYDOXHLQ5E DQG,PP/RDGWKHE\WHYDOXHDW WKHDGGUHVVLQWR5G /'55G>5E,PP@ /'55G>5E,PP@ 675%5G>5E,PP@ 675%5G>5E,PP@ /'5%5G>5E,PP@ /'5%5G>5E,PP@ 127( )RUZRUGDFFHVVHV% WKHYDOXHVSHFLILHGE\,PPLVDIXOOELWDGGUHVVEXWPXVWEHZRUGDOLJQHG LHZLWKELWVVHWWRVLQFHWKHDVVHPEOHUSODFHV,PP!!LQWKH2IIVHWILHOG ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 /'5 5>5@ /RDGLQWR5WKHZRUGIRXQGDWWKH DGGUHVVIRUPHGE\DGGLQJWR5 1RWHWKDWWKH7+80%RSFRGHZLOO FRQWDLQDVWKH2IIVHWYDOXH 6WRUHWKHORZHUELWVRI5DWWKH DGGUHVVIRUPHGE\DGGLQJWR5 1RWHWKDWWKH7+80%RSFRGHZLOO FRQWDLQDVWKH2IIVHWYDOXH 675% 5>5@ .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$7/2$'6725(+$/):25' / 2IIVHW 5E 5G >@6RXUFH'HVWLQDWLRQUHJLVWHU >@%DVHUHJLVWHU >@,PPHGLDWHYDOXH >@/RDG6WRUHELW 6WRUHWRPHPRU\ /RDGIURPPRPRU\ )LJXUH)RUPDW 23(5$7,21 7KHVHLQVWUXFWLRQVWUDQVIHUKDOIZRUGYDOXHVEHWZHHQD/RUHJLVWHUDQGPHPRU\$GGUHVVHVDUHSUHLQGH[HGXVLQJ DELWLPPHGLDWHYDOXH7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQ7DEOH 7DEOH+DOIZRUG'DWD7UDQVIHU,QVWUXFWLRQV / 7+80%DVVHPEOHU $50HTXLYDOHQW $FWLRQ 675+5G>5E,PP@ 675+5G>5E,PP@ $GG,PPWREDVHDGGUHVVLQ5EDQG VWRUHELWVRI5GDWWKHUHVXOWLQJ DGGUHVV /'5+5G>5E,PP@ /'5+5G>5E,PP@ $GG,PPWREDVHDGGUHVVLQ5E/RDG ELWVIURPWKHUHVXOWLQJDGGUHVVLQWR 5GDQGVHWELWVWR]HUR 127( ,PPLVDIXOOELWDGGUHVVEXWPXVWEHKDOIZRUGDOLJQHGLHZLWKELWVHWWR VLQFHWKHDVVHPEOHUSODFHV,PP!!LQWKH2IIVHWILHOG 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 675+ 5>5@ 6WRUHWKHORZHUELWVRI5DWWKHDGGUHVVIRUPHGE\ DGGLQJ51RWHWKDWWKH7+80%RSFRGHZLOOFRQWDLQ DVWKH2IIVHWYDOXH /RDGLQWR5WKHKDOIZRUGIRXQGDWWKHDGGUHVVIRUPHGE\ DGGLQJWR51RWHWKDWWKH7+80%RSFRGHZLOOFRQWDLQ DVWKH2IIVHWYDOXH /'5+ 5>5@ .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$7635(/$7,9(/2$'6725( / 5G :RUG >@,PPHGLDWHYDOXH >@'HVWLQDWLRQUHJLVWHU >@/RDG6WRUHELW 6WRUHWRPHPRU\ /RDGIURPPHPRU\ )LJXUH)RUPDW 23(5$7,21 7KHLQVWUXFWLRQVLQWKLVJURXSSHUIRUPDQ63UHODWLYHORDGRUVWRUH7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQWKH IROORZLQJWDEOH 7DEOH635HODWLYH/RDG6WRUH,QVWUXFWLRQV / 7+80%DVVHPEOHU 6755G>63,PP@ $50HTXLYDOHQW 6755G>5,PP@ $FWLRQ $GGXQVLJQHGRIIVHWZRUGV E\WHVLQ,PPWRWKHFXUUHQWYDOXHRIWKH 6356WRUHWKHFRQWHQWVRI5GDWWKH UHVXOWLQJDGGUHVV $GGXQVLJQHGRIIVHWZRUGV E\WHVLQ,PPWRWKHFXUUHQWYDOXHRIWKH 635/RDGWKHZRUGIURPWKH UHVXOWLQJDGGUHVVLQWR5G /'55G>63,PP@ /'55G>5,PP@ 127( 7KHRIIVHWVXSSOLHGLQ,PPLVDIXOOELWDGGUHVVEXWPXVWDOZD\VEHZRUGDOLJQHGLHELWVVHWWR VLQFHWKHDVVHPEOHUSODFHV,PP!!LQWKH:RUGILHOG 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 675 5>63@ 6WRUHWKHFRQWHQWVRI5DWWKHDGGUHVV IRUPHGE\DGGLQJWR635 1RWHWKDWWKH7+80%RSFRGHZLOOFRQWDLQ DVWKH:RUGYDOXH .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$7/2$'$''5(66 63 5G :RUG >@ELWXQVLJQHGFRQVWDQW >@'HVWLQDWLRQUHJLVWHU >@6RXUFH 3& 63 )LJXUH)RUPDW 23(5$7,21 7KHVHLQVWUXFWLRQVFDOFXODWHDQDGGUHVVE\DGGLQJDQELWFRQVWDQWWRHLWKHUWKH3&RUWKH63DQGORDGWKH UHVXOWLQJDGGUHVVLQWRDUHJLVWHU7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQWKHIROORZLQJWDEOH 7DEOH/RDG$GGUHVV 63 7+80%DVVHPEOHU $''5G3&,PP $50HTXLYDOHQW $''5G5,PP $FWLRQ $GG,PPWRWKHFXUUHQWYDOXH RIWKHSURJUDPFRXQWHU3& DQGORDGWKHUHVXOWLQWR5G $GG,PPWRWKHFXUUHQWYDOXH RIWKHVWDFNSRLQWHU63DQG ORDGWKHUHVXOWLQWR5G $''5G63,PP $''5G5,PP 127( 7KHYDOXHVSHFLILHGE\,PPLVDIXOOELWYDOXHEXWWKLVPXVWEHZRUGDOLJQHGLHZLWKELWVVHWWR VLQFHWKHDVVHPEOHUSODFHV,PP!!LQILHOG:RUG :KHUHWKH3&LVXVHGDVWKHVRXUFHUHJLVWHU63 ELWRIWKH3&LVDOZD\VUHDGDV7KHYDOXHRIWKH3&ZLOO EHE\WHVJUHDWHUWKDQWKHDGGUHVVRIWKHLQVWUXFWLRQEHIRUHELWLVIRUFHGWR 7KH&365FRQGLWLRQFRGHVDUHXQDIIHFWHGE\WKHVHLQVWUXFWLRQV 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 $'' 53& 5 3&EXWGRQWVHWWKH FRQGLWLRQFRGHVELW>@RI3&LVIRUFHGWR]HUR 1RWHWKDWWKH7+80%RSFRGHZLOO FRQWDLQDVWKH:RUGYDOXH 5 635EXWGRQW VHWWKHFRQGLWLRQFRGHV 1RWHWKDWWKH7+80%RSFRGHZLOO FRQWDLQDVWKH:RUGYDOXH $'' 563 .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$7$''2))6(77267$&.32,17(5 6 6:RUG >@ELWLPPHGLDWHYDOXH >@6LJQIODJ 2IIVHWLVSRVLWLYH 2IIVHWLVQHJDWLYH )LJXUH)RUPDW 23(5$7,21 7KLVLQVWUXFWLRQDGGVDELWVLJQHGFRQVWDQWWRWKHVWDFNSRLQWHU7KHIROORZLQJWDEOHVKRZVWKH7+80%DVVHPEOHU V\QWD[ 7DEOH7KH$''63,QVWUXFWLRQ 6 7+80%DVVHPEOHU $''63,PP $''63,PP $50HTXLYDOHQW $FWLRQ $''55,PP $GG,PPWRWKHVWDFNSRLQWHU63 68%55,PP $GG,PPWRWKHVWDFNSRLQWHU63 127( 7KHRIIVHWVSHFLILHGE\,PPFDQEHXSWREXWPXVWEHZRUGDOLJQHGLHZLWKELWVVHWWR VLQFHWKHDVVHPEOHUFRQYHUWV,PPWRDQELWVLJQPDJQLWXGHQXPEHUEHIRUHSODFLQJLWLQILHOG6:RUG 7KHFRQGLWLRQFRGHVDUHQRWVHWE\WKLVLQVWUXFWLRQ 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 $'' 63 635 63EXWGRQWVHWWKHFRQGLWLRQFRGHV 1RWHWKDWWKH7+80%RSFRGHZLOO FRQWDLQDVWKH:RUGYDOXHDQG6 635 63EXWGRQWVHWWKHFRQGLWLRQFRGHV 1RWHWKDWWKH7+80%RSFRGHZLOOFRQWDLQ DVWKH:RUGYDOXHDQG6 $'' 63 .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$7386+3235(*,67(56 / 5 5OLVW >@5HJLVWHUOLVW >@3&/5ELW 'RQRWVWRUH/5/RDG3& 6WRUH/5/RDG3& >@/RDG6WRUHELW 6WRUHWRPHPRU\ /RDGIURPPHPRU\ )LJXUH)RUPDW 23(5$7,21 7KHLQVWUXFWLRQVLQWKLVJURXSDOORZUHJLVWHUVDQGRSWLRQDOO\/5WREHSXVKHGRQWRWKHVWDFNDQGUHJLVWHUV DQGRSWLRQDOO\3&WREHSRSSHGRIIWKHVWDFN7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQ7DEOH 127( 7KHVWDFNLVDOZD\VDVVXPHGWREH)XOO'HVFHQGLQJ 7DEOH386+DQG323,QVWUXFWLRQV / 5 7+80%DVVHPEOHU 386+^5OLVW` $50HTXLYDOHQW 670'%5^5OLVW` $FWLRQ 3XVKWKHUHJLVWHUVVSHFLILHGE\ 5OLVWRQWRWKHVWDFN8SGDWHWKH VWDFNSRLQWHU 3XVKWKH/LQN5HJLVWHUDQGWKH UHJLVWHUVVSHFLILHGE\5OLVWLI DQ\RQWRWKHVWDFN8SGDWHWKH VWDFNSRLQWHU 3RSYDOXHVRIIWKHVWDFNLQWRWKH UHJLVWHUVVSHFLILHGE\5OLVW 8SGDWHWKHVWDFNSRLQWHU 3RSYDOXHVRIIWKHVWDFNDQG ORDGLQWRWKHUHJLVWHUVVSHFLILHG E\5OLVW3RSWKH3&RIIWKH VWDFN8SGDWHWKHVWDFNSRLQWHU 386+^5OLVW/5` 670'%5^5OLVW5` 323^5OLVW` /'0,$5^5OLVW` 323^5OLVW3&` /'0,$5^5OLVW5` 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 386+ ^55/5` 6WRUH55555DQG5/5DW WKHVWDFNSRLQWHGWRE\563DQGXSGDWH5 8VHIXODWVWDUWRIDVXEURXWLQHWR VDYHZRUNVSDFHDQGUHWXUQDGGUHVV /RDG55DQG53&IURPWKHVWDFN SRLQWHGWRE\563DQGXSGDWH5 8VHIXOWRUHVWRUHZRUNVSDFHDQGUHWXUQIURPVXEURXWLQH 323 ^553&` .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$708/7,3/(/2$'6725( / 5E 5OLVW >@5HJLVWHUOLVW >@%DVHUHJLVWHU >@/RDG6WRUHELW 6WRUHWRPHPRU\ /RDGIURPPHPRU\ )LJXUH)RUPDW 23(5$7,21 7KHVHLQVWUXFWLRQVDOORZPXOWLSOHORDGLQJDQGVWRULQJRI/RUHJLVWHUV7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQWKH IROORZLQJWDEOH 7DEOH7KH0XOWLSOH/RDG6WRUH,QVWUXFWLRQV / 7+80%DVVHPEOHU 670,$5E^5OLVW` $50HTXLYDOHQW 670,$5E^5OLVW` $FWLRQ 6WRUHWKHUHJLVWHUVVSHFLILHGE\ 5OLVWVWDUWLQJDWWKHEDVH DGGUHVVLQ5E:ULWHEDFNWKH QHZEDVHDGGUHVV /RDGWKHUHJLVWHUVVSHFLILHGE\ 5OLVWVWDUWLQJDWWKHEDVH DGGUHVVLQ5E:ULWHEDFNWKH QHZEDVHDGGUHVV /'0,$5E^5OLVW` /'0,$5E^5OLVW` ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 670,$ 5^55` 6WRUHWKHFRQWHQWVRIUHJLVWHUV55 VWDUWLQJDWWKHDGGUHVVVSHFLILHGLQ 5LQFUHPHQWLQJWKHDGGUHVVHVIRUHDFKZRUG :ULWHEDFNWKHXSGDWHGYDOXHRI5 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 )250$7&21',7,21$/%5$1&+ &RQG 62IIVHW >@ELWVLJQHGLPPHGLDWH >@&RQGLWLRQ )LJXUH)RUPDW 23(5$7,21 7KHLQVWUXFWLRQVLQWKLVJURXSDOOSHUIRUPDFRQGLWLRQDO%UDQFKGHSHQGLQJRQWKHVWDWHRIWKH&365FRQGLWLRQFRGHV 7KHEUDQFKRIIVHWPXVWWDNHDFFRXQWRIWKHSUHIHWFKRSHUDWLRQZKLFKFDXVHVWKH3&WREHZRUGE\WHVDKHDG RIWKHFXUUHQWLQVWUXFWLRQ 7KH7+80%DVVHPEOHUV\QWD[LVVKRZQLQWKHIROORZLQJWDEOH 7DEOH7KH&RQGLWLRQDO%UDQFK,QVWUXFWLRQV &RQG 7+80%DVVHPEOHU %(4ODEHO %1(ODEHO %&6ODEHO %&&ODEHO %0,ODEHO %3/ODEHO %96ODEHO %9&ODEHO %+,ODEHO %/6ODEHO %*(ODEHO $50HTXLYDOHQW %(4ODEHO %1(ODEHO %&6ODEHO %&&ODEHO %0,ODEHO %3/ODEHO %96ODEHO %9&ODEHO %+,ODEHO %/6ODEHO %*(ODEHO $FWLRQ %UDQFKLI=VHWHTXDO %UDQFKLI=FOHDUQRWHTXDO %UDQFKLI&VHWXQVLJQHGKLJKHU RUVDPH %UDQFKLI&FOHDUXQVLJQHG ORZHU %UDQFKLI1VHWQHJDWLYH %UDQFKLI1FOHDUSRVLWLYHRU ]HUR %UDQFKLI9VHWRYHUIORZ %UDQFKLI9FOHDUQRRYHUIORZ %UDQFKLI&VHWDQG=FOHDU XQVLJQHGKLJKHU %UDQFKLI&FOHDURU=VHW XQVLJQHGORZHURUVDPH %UDQFKLI1VHWDQG9VHWRU1 FOHDUDQG9FOHDUJUHDWHURU HTXDO .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 7DEOH7KH&RQGLWLRQDO%UDQFK,QVWUXFWLRQV&RQWLQXHG &RQG 7+80%DVVHPEOHU %/7ODEHO %*7ODEHO $50HTXLYDOHQW %/7ODEHO %*7ODEHO $FWLRQ %UDQFKLI1VHWDQG9FOHDURU1 FOHDUDQG9VHWOHVVWKDQ %UDQFKLI=FOHDUDQGHLWKHU1 VHWDQG9VHWRU1FOHDUDQG9 FOHDUJUHDWHUWKDQ %UDQFKLI=VHWRU1VHWDQG9 FOHDURU1FOHDUDQG9VHWOHVV WKDQRUHTXDO %/(ODEHO %/(ODEHO 127(6 :KLOHODEHOVSHFLILHVDIXOOELWWZRVFRPSOHPHQWDGGUHVVWKLVPXVWDOZD\VEHKDOIZRUGDOLJQHGLHZLWKELWVHWWR VLQFHWKHDVVHPEOHUDFWXDOO\SODFHVODEHO!!LQILHOG62IIVHW &RQG LVXQGHILQHGDQGVKRXOGQRWEHXVHG &RQG FUHDWHVWKH6:,LQVWUXFWLRQVHH ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 &035 %*7RYHU %UDQFKWRRYHULI5! 1RWHWKDWWKH7+80%RSFRGHZLOOFRQWDLQ WKHQXPEHURIKDOIZRUGVWRRIIVHW 0XVWEHKDOIZRUGDOLJQHG RYHU 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 )250$762)7:$5(,17(55837 9DOXH >@&RPPHQWILHOG )LJXUH)RUPDW 23(5$7,21 7KH6:,LQVWUXFWLRQSHUIRUPVDVRIWZDUHLQWHUUXSW2QWDNLQJWKH6:,WKHSURFHVVRUVZLWFKHVLQWR$50VWDWHDQG HQWHUV6XSHUYLVRU69&PRGH 7KH7+80%DVVHPEOHUV\QWD[IRUWKLVLQVWUXFWLRQLVVKRZQEHORZ 7DEOH7KH6:,,QVWUXFWLRQ 7+80%$VVHPEOHU 6:,9DOXH $50(TXLYDOHQW 6:,9DOXH $FWLRQ 3HUIRUP6RIWZDUH,QWHUUXSW 0RYHWKHDGGUHVVRIWKHQH[WLQVWUXFWLRQ LQWR/5PRYH&365WR6365ORDGWKH 6:,YHFWRUDGGUHVV[LQWRWKH3& 6ZLWFKWR$50VWDWHDQGHQWHU69& PRGH 127( 9DOXHLVXVHGVROHO\E\WKH6:,KDQGOHULWLVLJQRUHGE\WKHSURFHVVRU ,16758&7,21&<&/(7,0(6 $OOLQVWUXFWLRQVLQWKLVIRUPDWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQDVVKRZQLQ7DEOH7KHLQVWUXFWLRQF\FOH WLPHVIRUWKH7+80%LQVWUXFWLRQDUHLGHQWLFDOWRWKDWRIWKHHTXLYDOHQW$50LQVWUXFWLRQ (;$03/(6 6:, 7DNHWKHVRIWZDUHLQWHUUXSWH[FHSWLRQ (QWHU6XSHUYLVRUPRGHZLWKDVWKH UHTXHVWHG6:,QXPEHU .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 )250$781&21',7,21$/%5$1&+ 2IIVHW >@,PPHGLDWHYDOXH )LJXUH)RUPDW 23(5$7,21 7KLVLQVWUXFWLRQSHUIRUPVD3&UHODWLYH%UDQFK7KH7+80%DVVHPEOHUV\QWD[LVVKRZQEHORZ7KHEUDQFKRIIVHW PXVWWDNHDFFRXQWRIWKHSUHIHWFKRSHUDWLRQZKLFKFDXVHVWKH3&WREHZRUGE\WHVDKHDGRIWKHFXUUHQW LQVWUXFWLRQ 7DEOH6XPPDU\RI%UDQFK,QVWUXFWLRQ 7+80%$VVHPEOHU %ODEHO $50(TXLYDOHQW %$/ODEHOKDOIZRUG RIIVHW $FWLRQ %UDQFK3&UHODWLYH2IIVHW ZKHUHODEHOLV3&E\WHV 127( 7KHDGGUHVVVSHFLILHGE\ODEHOLVDIXOOELWWZRVFRPSOHPHQWDGGUHVV EXWPXVWDOZD\VEHKDOIZRUGDOLJQHGLHELWVHWWRVLQFHWKHDVVHPEOHUSODFHVODEHO!!LQWKH2IIVHWILHOG (;$03/(6 KHUH %KHUH %MLPP\ MLPP\ %UDQFKRQWRLWVHOI$VVHPEOHVWR[()( 1RWHHIIHFWRI3&RIIVHW %UDQFKWRMLPP\ 1RWHWKDWWKH7+80%RSFRGHZLOOFRQWDLQWKHQXPEHURI KDOIZRUGVWRRIIVHW 0XVWEHKDOIZRUGDOLJQHG 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 )250$7/21*%5$1&+:,7+/,1. + 2IIVHW >@/RQJEUDQFKDQGOLQNRIIVHWKLJKORZ >@/RZ+LJKRIIVHWELW 2IIVHWKLJK 2IIVHWORZ )LJXUH)RUPDW 23(5$7,21 7KLVIRUPDWVSHFLILHVDORQJEUDQFKZLWKOLQN 7KHDVVHPEOHUVSOLWVWKHELWWZRVFRPSOHPHQWKDOIZRUGRIIVHWVSHFLIHGE\WKHODEHOLQWRWZRELWKDOYHV LJQRULQJELWZKLFKPXVWEHDQGFUHDWHVWZR7+80%LQVWUXFWLRQV ,QVWUXFWLRQ+ ,QWKHILUVWLQVWUXFWLRQWKH2IIVHWILHOGFRQWDLQVWKHXSSHUELWVRIWKHWDUJHWDGGUHVV7KLVLVVKLIWHGOHIWE\ELWV DQGDGGHGWRWKHFXUUHQW3&DGGUHVV7KHUHVXOWLQJDGGUHVVLVSODFHGLQ/5 ,QVWUXFWLRQ+ ,QWKHVHFRQGLQVWUXFWLRQWKH2IIVHWILHOGFRQWDLQVDQELWUHSUHVHQWDWLRQORZHUKDOIRIWKHWDUJHWDGGUHVV7KLVLV VKLIWHGOHIWE\ELWDQGDGGHGWR/5/5ZKLFKQRZFRQWDLQVWKHIXOOELWDGGUHVVLVSODFHGLQ3&WKHDGGUHVVRI WKHLQVWUXFWLRQIROORZLQJWKH%/LVSODFHGLQ/5DQGELWRI/5LVVHW 7KHEUDQFKRIIVHWPXVWWDNHDFFRXQWRIWKHSUHIHWFKRSHUDWLRQZKLFKFDXVHVWKH3&WREHZRUGE\WHVDKHDG RIWKHFXUUHQWLQVWUXFWLRQ .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 ,16758&7,21&<&/(7,0(6 7KLVLQVWUXFWLRQIRUPDWGRHVQRWKDYHDQHTXLYDOHQW$50LQVWUXFWLRQ 7DEOH7KH%/,QVWUXFWLRQ + 7+80%DVVHPEOHU %/ODEHO $50HTXLYDOHQW QRQH $FWLRQ /5 3&2IIVHW+LJK WHPS QH[WLQVWUXFWLRQDGGUHVV 3& /52IIVHW/RZ /5 WHPS_ (;$03/(6 QH[W %/IDUDZD\ 8QFRQGLWLRQDOO\%UDQFKWRIDUDZD\ DQGSODFHIROORZLQJLQVWUXFWLRQ DGGUHVVLHQH[WLQ5WKH/LQN UHJLVWHUDQGVHWELWRI/5KLJK 1RWHWKDWWKH7+80%RSFRGHVZLOO FRQWDLQWKHQXPEHURIKDOIZRUGVWRRIIVHW 0XVWEH+DOIZRUGDOLJQHG IDUDZD\ 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 ,16758&7,216(7(;$03/(6 7KHIROORZLQJH[DPSOHVVKRZZD\VLQZKLFKWKH7+80%LQVWUXFWLRQVPD\EHXVHGWRJHQHUDWHVPDOODQGHIILFLHQW FRGH(DFKH[DPSOHDOVRVKRZVWKH$50HTXLYDOHQWVRWKHVHPD\EHFRPSDUHG 08/7,3/,&$7,21%<$&2167$1786,1*6+,)76$1'$''6 7KHIROORZLQJVKRZVFRGHWRPXOWLSO\E\YDULRXVFRQVWDQWVXVLQJRU7KXPELQVWUXFWLRQVDORQJVLGHWKH$50 HTXLYDOHQWV)RURWKHUFRQVWDQWVLWLVJHQHUDOO\EHWWHUWRXVHWKHEXLOWLQ08/LQVWUXFWLRQUDWKHUWKDQXVLQJD VHTXHQFHRIRUPRUHLQVWUXFWLRQV 7KXPE 0XOWLSOLFDWLRQE\AQ /6/ 5D5E/6/Q 0295D5E/6/Q $50 0XOWLSOLFDWLRQE\AQ /6/ $'' 5W5EQ 5D5W5E $''5D5E5E/6/Q 0XOWLSOLFDWLRQE\AQ /6/ 68% 5W5EQ 5D5W5E 56%5D5E5E/6/Q 0XOWLSOLFDWLRQE\AQ /6/ 091 5D5EQ 5D5D 0295D5E/6/Q 56%5D5D 0XOWLSOLFDWLRQE\AQ /6/ 68% 5W5EQ 5D5E5W 68%5D5E5E/6/Q 0XOWLSOLFDWLRQE\DQ\& ^AQAQAQRUAQ`AQ (IIHFWLYHO\WKLVLVDQ\RIWKHPXOWLSOLFDWLRQVLQWRIROORZHGE\DILQDOVKLIW7KLVDOORZVWKHIROORZLQJDGGLWLRQDO FRQVWDQWVWREHPXOWLSOLHG /6/ 5D5DQ 0295D5D/6/Q .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 *(1(5$/385326(6,*1('',9,'( 7KLVH[DPSOHVKRZVDJHQHUDOSXUSRVHVLJQHGGLYLGHDQGUHPDLQGHUURXWLQHLQERWK7KXPEDQG$50FRGH 7KXPEFRGH VLJQHGBGLYLGH *HWDEVYDOXHRI5LQWR5 $65 55 (25 55 68% 555 6LJQHGGLYLGHRI5E\5UHWXUQVTXRWLHQWLQ5 UHPDLQGHULQ5 *HWRULQ5GHSHQGLQJRQVLJQRI5 (25ZLWK[))))))))LIQHJDWLYH DQG$''68%WRJHWDEVYDOXH 68%DOZD\VVHWVIODJVRJRUHSRUWGLYLVLRQE\LIQHFHVVDU\ %(4 GLYLGHBE\B]HUR *HWDEVYDOXHRI5E\[RULQJZLWK[))))))))DQGDGGLQJLIQHJDWLYH $65 55 *HWRULQ5GHSHQGLQJRQVLJQRI5 (25 55 (25ZLWK[))))))))LIQHJDWLYH 68% 55 DQG$''68%WRJHWDEVYDOXH 6DYHVLJQVRULQ55IRUODWHUXVHLQGHWHUPLQLQJVLJQRITXRWLHQWUHPDLQGHU 386+ ^55` -XVWLILFDWLRQVKLIWELWDWDWLPHXQWLOGLYLVRU5YDOXHLVMXVW WKDQGLYLGHQG5YDOXH7RGRWKLVVKLIW GLYLGHQGULJKWE\DQGVWRSDVVRRQDVVKLIWHGYDOXHEHFRPHV! /65 55 029 55 % )7 MXVWBO /6/ 5 &03 55 %/6 MXVWBO 029 % GLYBO /65 &03 %&& 68% $'& &03 %1( 5 )7 5 55 )7 55 55 55 GLYBO 6HWDFFXPXODWRUWR %UDQFKLQWRGLYLVLRQORRS 7HVWVXEWUDFW ,IVXFFHVVIXOGRDUHDOVXEWUDFW 6KLIWUHVXOWDQGDGGLIVXEWUDFWVXFFHHGHG 7HUPLQDWHZKHQ5 5LHZHKDYHMXVW WHVWHGVXEWUDFWLQJWKHRQHVYDOXH 7+80%,16758&7,216(7 .6&5,6&0,&52&21752/(5 1RZIL[XSWKHVLJQVRIWKHTXRWLHQW5DQGUHPDLQGHU5 323 ^55` *HWGLYLGHQGGLYLVRUVLJQVEDFN (25 55 5HVXOWVLJQ (25 55 1HJDWHLIUHVXOWVLJQ 68% 55 (25 55 1HJDWHUHPDLQGHULIGLYLGHQGVLJQ 68% 55 029 SFOU $50&RGH VLJQHGBGLYLGH $1'6 56%0, (256 LSELW VLJQRIUHVXOW LSELW VLJQRID 56%&6 (IIHFWLYHO\]HURDDVWRSELWZLOOEHVKLIWHGRXWODWHU DD DD LSDD$65 DD &HQWUDOSDUWLVLGHQWLFDOFRGHWRXGLYZLWKRXW029DZKLFKFRPHVIRUIUHHDVSDUWRIVLJQHGHQWU\VHTXHQFH 0296 DD %(4 GLYLGHBE\B]HUR MXVWBO &03 029/6 %/2 GLYBO &03 $'& 68%&6 7(4 0291( %1( 029 0296 56%&6 56%0, 029 DD DDD DDD DD DD/65 VBORRS DD LSLS$6/ DD DD SFOU DD/65 DD/6/ VBORRS -XVWLILFDWLRQVWDJHVKLIWVELWDWDWLPH 1%/6/LVDOZD\V2.LI/6VXFFHHGV .6&5,6&0,&52&21752//(5 7+80%,16758&7,216(7 ',9,6,21%<$&2167$17 'LYLVLRQE\DFRQVWDQWFDQRIWHQEHSHUIRUPHGE\DVKRUWIL[HGVHTXHQFHRIVKLIWVDGGVDQGVXEWUDFWV +HUHLVDQH[DPSOHRIDGLYLGHE\URXWLQHEDVHGRQWKHDOJRULWKPLQWKH$50&RRNERRNLQERWK7KXPEDQG$50 FRGH 7KXPE&RGH XGLY 029 /65 68% /65 $'' /65 $'' /65 $'' /65 $6/ $'' $6/ 68% &03 %/7 $'' 68% 029 $50&RGH XGLY 68% 68% $'' $'' $'' 029 $'' 68%6 $''3/ $''0, 029 DD DDDOVU DDDOVU DDDOVU DDDOVU DDOVU DDDDVO DDDDVO DD DD SFOU 7DNHDUJXPHQWLQDUHWXUQVTXRWLHQWLQD UHPDLQGHULQD SFOU DD DD DD DD DD DD DD DD DD D DD DD D DD D )7 D D 7DNHDUJXPHQWLQDUHWXUQVTXRWLHQWLQD UHPDLQGHULQD $50,16758&7,216(7 .6&5,6&0,&52&21752/(5 127(6 .6&5,6&0,&52&21752//(5 6<67(00$1$*(5 29(59,(: 6<67(00$1$*(5 7KH.6&PLFURFRQWUROOHUV6\VWHP0DQDJHUKDVWKHIROORZLQJIXQFWLRQV 7RDUELWUDWHV\VWHPEXVDFFHVVUHTXHVWVIURPVHYHUDOPDVWHUEORFNVEDVHGRQIL[HGSULRULWLHV 7RSURYLGHWKHUHTXLUHGPHPRU\FRQWUROVLJQDOVIRUH[WHUQDOPHPRU\DFFHVVHV)RUH[DPSOHLIDPDVWHUEORFN VXFKDVWKH'0$FRQWUROOHURUWKH&38JHQHUDWHVDQDGGUHVVZKLFKFRUUHVSRQGVWRD'5$0EDQNWKH6\VWHP 0DQDJHUV'5$0FRQWUROOHUJHQHUDWHVWKHUHTXLUHGQRUPDO('2RU6'5$0DFFHVVVLJQDOV7KHLQWHUIDFH VLJQDOVIRUQRUPDO('2RU6'5$0FDQEHVZLWFKHGE\6<6&)*>@ 7RSURYLGHWKHUHTXLUHGVLJQDOVIRUEXVWUDIILFEHWZHHQWKH.6&DQG52065$0DQGWKHH[WHUQDO,2 EDQNV 7RFRPSHQVDWHIRUGLIIHUHQFHVLQEXVZLGWKIRUGDWDIORZLQJEHWZHHQWKHH[WHUQDOPHPRU\EXVDQGWKHLQWHUQDO GDWDEXV .6&VXSSRUWVERWKOLWWOHDQGELJHQGLDQIRUH[WHUQDOPHPRU\RU,2GHYLFHV,QWHUQDOUHJLVWHUV KRZHYHURSHUDWHXQGHUELJHQGLDQPRGH 127( %\JHQHUDWLQJDQH[WHUQDOEXVUHTXHVWDQH[WHUQDOGHYLFHFDQDFFHVVWKH.6&VH[WHUQDO PHPRU\LQWHUIDFHSLQV,QDGGLWLRQWKH.6&FDQDFFHVVVORZH[WHUQDOGHYLFHVXVLQJD :DLWVLJQDO7KH:DLWVLJQDOZKLFKLVJHQHUDWHGE\WKHH[WHUQDOGHYLFHH[WHQGVWKHGXUDWLRQRIWKH &38VPHPRU\DFFHVVF\FOHEH\RQGLWVSURJUDPPDEOHYDOXH .6&5,6&0,&52&21752//(5 81,),(',16758&7,21'$7$&$&+( 81,),(',16758&7,21'$7$&$&+( 7KH.6&&38KDVDXQLILHGLQWHUQDO.E\WHLQVWUXFWLRQGDWDFDFKH8VLQJFDFKHFRQWUROUHJLVWHUVHWWLQJV \RXFDQXVHSDUWRUDOORIWKLVFDFKHDVLQWHUQDO65$07RUDLVHWKHFDFKHKLWUDWLRWKHFDFKHLVFRQILJXUHGXVLQJ WZRZD\VHWDVVRFLDWLYHDGGUHVVLQJ7KHUHSODFHPHQWDOJRULWKPLVSVHXGR/58/HDVW5HFHQWO\8VHG 7KHFDFKHOLQHVL]HLVIRXUZRUGVE\WHV:KHQDPLVVRFFXUVIRXUZRUGVPXVWEHIHWFKHGFRQVHFXWLYHO\IURP H[WHUQDOPHPRU\7\SLFDOO\5,6&SURFHVVRUVWDNHDGYDQWDJHRIXQLILHGLQVWUXFWLRQGDWDFDFKHVWRLPSURYH SHUIRUPDQFH:LWKRXWDQLQVWUXFWLRQFDFKHERWWOHQHFNVWKDWRFFXUGXULQJLQVWUXFWLRQIHWFKHVIURPH[WHUQDOPHPRU\ PD\VHULRXVO\GHJUDGHSHUIRUPDQFH &$&+(&21),*85$7,21 7KH.6&V.E\WHWZRZD\VHWDVVRFLDWLYHLQVWUXFWLRQGDWDFDFKHXVHVDELWWDJDGGUHVVIRUHDFKVHW 7KH&6ELWVDELWYDOXHLQWDJPHPRU\VWRUHVLQIRUPDWLRQIRUFDFKHUHSODFHPHQW:KHQDUHVHWRFFXUVWKH&6 YDOXHLVLQGLFDWLQJWKDWWKHFRQWHQWVRIFDFKHVHWDQGFDFKHVHWDUHLQYDOLG:KHQWKHILUVWFDFKHILOO RSHUDWLRQRFFXUVZKLOHH[LWLQJIURPWKHUHVHWRSHUDWLRQWKH&6YDOXHEHFRPHVDWWKHVSHFLILHGOLQHWRLQGLFDWH WKDWRQO\VHWLVYDOLG:KHQWKHVXEVHTXHQWFDFKHILOORFFXUVWKH&6YDOXHEHFRPHVDWWKHVSHFLILHGOLQH LQGLFDWLQJWKDWWKHFRQWHQWVRIERWKVHWDQGVHWDUHYDOLG 81,),(',16758&7,21'$7$&$&+( .6&5,6&0,&52&21752//(5 7DJ$GGUHVVELW (QDEOHQRQFDFKHDEOHFRQWURO 6HWGLUHFWDFFHVV 6HWGLUHFWDFFHVV 7$*GLUHFWDFFHVV 6ZLWFK &6 6HW7DJ 6HW7DJ +HLJKW ELWV ELWV 'HFRGHU ELWV 7DJ5$0ELW 6HW,&DFKH LQVWUXFWLRQGDWDELW ,QVWU ,QVWU 6HW,&DFKH LQVWUXFWLRQGDWDELW ,QVWU ,QVWU ,QVWU ELW ,QVWU ,QVWU ELW ,QVWU +HLJKW 6HW+LW 6HW+LW )LJXUH0HPRU\&RQILJXUDWLRQIRU.E\WHRU.E\WH&DFKH .6&5,6&0,&52&21752//(5 81,),(',16758&7,21'$7$&$&+( &$&+(5(3/$&(23(5$7,216 :KHQWKHFRQWHQWVRIWZRVHWVDUHYDOLGDQGZKHQWKHFRQWHQWRIWKHFDFKHPXVWEHUHSODFHGGXHWRDFDFKHPLVV WKH&6YDOXHEHFRPHVDWVSHFLILHGOLQH7KLVLQGLFDWHVWKDWWKHFRQWHQWRIVHW6ZDVUHSODFHG:KHQ&6LV DQGZKHQDQRWKHUUHSODFHPHQWLVUHTXLUHGGXHWRDFDFKHPLVVWKHFRQWHQWRIVHW6LVUHSODFHGE\ FKDQJLQJWKH&6YDOXHWR 7RVXPPDUL]HDWLWVQRUPDOVWHDG\VWDWHWKH&6YDOXHLVFKDQJHGIURPRUWRRU7KLV PRGLILFDWLRQSURYLGHVWKHLQIRUPDWLRQQHFHVVDU\WRLPSOHPHQWDELWSVHXGR/58/HDVW5HFHQWO\8VHGFDFKH UHSODFHPHQWSROLF\ 5HVHW 6HWVHWDOOLQYDOLG &DFKHPLVVRFFXUV 6HW YDOLGVHW LQYDOLG 6WDWXVGRHVQRWFKDQJHRQKLW +LW 0LVVRUKLW $96' 0LVVRUKLW +LW 5HDGPLVV $9B6' $OOYDOLGDQGVHWLVGLUW\ 'LUW\PHDQVWRDFFHVVMXVWEHIRUH VWDWXVGRHVQRWFKDQJHRQKLW $9B6' $OOYDOLGDQGVHWLVGLUW\ 19$/,' 0LVV 6RQO\ 0LVV $96' +LW )LJXUH&DFKH5HSODFH$OJRULWKP6WDWH'LDJUDP 81,),(',16758&7,21'$7$&$&+( .6&5,6&0,&52&21752//(5 &$&+(',6$%/((1$%/( 7RGLVDEOHWKHFDFKHGLVDEOHHQWLUHO\IROORZLQJDV\VWHPUHVHW\RXPXVWVHW6<6&)*>@WR%\VHWWLQJWKHFDFKH PRGHELWV6<6&)*>@\RXFDQVSHFLI\DFDFKHVL]HRIRU.E\WHV,I\RXGRQRWQHHGWKHHQWLUH.E\WH DUHDIRUFDFKH\RXFDQXVHWKHUHPDLQLQJDUHDDVQRUPDOLQWHUQDO65$07KHVWDUWDGGUHVVRIWKHLQWHUQDO65$0 DUHDLVGHILQHGE\ZULWLQJDQDSSURSULDWHYDOXHWR6<6&)*>@ &$&+()/86+23(5$7,21 7RIOXVKFDFKHOLQHV\RXPXVWZULWHD]HURWR7DJPHPRU\ELWVDQGUHVSHFWLYHO\ 7KH.E\WHVHW5$0DUHD.E\WHVHW5$0DUHDDQGWKH.E\WH7DJ5$0DUHDWRWDOZRUGVFDQEH DFFHVVHGIURPORFDWLRQV[+[+DQG[+UHVSHFWLYHO\<RXFDQGRWKLV LQGHSHQGHQWO\RIWKHFXUUHQWFDFKHPRGHELWDQGFDFKHHQDEOHELWVHWWLQJV 7DJ5$0LVQRUPDOO\FOHDUHGE\KDUGZDUHIROORZLQJDSRZHURQUHVHW+RZHYHULI\RXFKDQJHWKHFDFKHRU PHPRU\EDQNFRQILJXUDWLRQZKHQWKHFDFKHLVEHLQJHQDEOHG\RXZLOOKDYHWRFOHDUWKH7DJ5$0DUHDXVLQJ DSSOLFDWLRQVRIWZDUH 121&$&+($%/($5($&21752/%,7 $OWKRXJKWKHFDFKHDIIHFWVWKHHQWLUHV\VWHPPHPRU\LWLVVRPHWLPHVQHFHVVDU\WRGHILQHQRQFDFKHDEOHDUHDV ZKHQWKHFRQVLVWHQF\RIGDWDVWRUHGLQPHPRU\DQGWKHFDFKHPXVWEHHQVXUHG7RVXSSRUWWKLVWKH.6& SURYLGHVDQRQFDFKHDEOHDUHDFRQWUROELWLQWKHDGGUHVVILHOG$''5>@ ,I$''5>@LQWKH52065$0IODVKPHPRU\'5$0RUH[WHUQDO,2EDQNVDFFHVVDGGUHVVLVWKHQWKH DFFHVVHGGDWDLVFDFKHDEOH,IWKH$''5>@YDOXHLVWKHDFFHVVHGGDWDLVQRQFDFKHDEOH &DFKHDEOHDUHD 1RQFDFKHDEOHDUHD B B B)))) 1RQFDFKHDEOH DUHD &DFKHDEOHDUHD B B 0ZRUG B B)))) &DFKHDEOHDUHD ))B)))) ))B)))) ))B)))) 127( 7KHQRQFDFKHDEOHDUHDKDVWKHVDPHVSDFHLQPHPRU\DVWKH FDFKHDEOHDUHD7RDFFHVVWKHQRQFDFKHDEOHDUHD\RXFDQ FKDQJHWKHDGGUHVVRIWKHVSDFHLQPHPRU\XVLQJQRQFDFKHDEOH FRQWUROELW )LJXUH1RQ&DFKHDEOH$UHD&RQWURO 127( $6:$3FRPPDQGPXVWEHXVHGZLWKLQDQRQFDVKHDEOHDUHD .6&5,6&0,&52&21752//(5 ,&%86&21752//(5 ,&%86&21752//(5 7KH.6&VLQWHUQDO,&EXV,&EXVFRQWUROOHUKDVWKHIROORZLQJLPSRUWDQWIHDWXUHV ,WUHTXLUHVRQO\WZREXVOLQHVDVHULDOGDWDOLQH6'$DQGDVHULDOFORFNOLQH6&/:KHQWKH,&EXVLVIUHH ERWKOLQHVDUH+LJKOHYHO (DFKGHYLFHWKDWLVFRQQHFWHGWRWKHEXVLVVRIWZDUHDGGUHVVDEOHE\DVLQJOHPDVWHUXVLQJDXQLTXHDGGUHVV 6ODYHUHODWLRQVKLSVRQWKHEXVDUHFRQVWDQW7KHEXVPDVWHUFDQEHHLWKHUDPDVWHUWUDQVPLWWHURUDPDVWHU UHFHLYHU7KH,&EXVFRQWUROOHUVXSSRUWVRQO\VLQJOHPDVWHUPRGH ,WVXSSRUWVELWELGLUHFWLRQDOVHULDOGDWDWUDQVIHUV 7KHQXPEHURI,&VWKDW\RXFDQFRQQHFWWRWKHVDPH,&EXVLVOLPLWHGRQO\E\WKHPD[LPXPEXVFDSDFLWDQFH RIS) )LJXUHVKRZVDEORFNGLDJUDPRIWKH.6&,&EXVFRQWUROOHU 6'$ '$7$ &21752/ 6+,)7%8))(55(*,67(5,,&%8) 6&/ 6&/ &21752/ 6(5,$/ &/2&. 35(6&$/(5 6<67(0&/2&.I 0&/. 35(6&$/(55(*,67(5,,&36 %86< &21 ' &21 ' $&. /5% ,(1 %) &21752/67$7865(*,67(5,,&&21 )LJXUH,&%XV%ORFN'LDJUDP ,&%86&21752//(5 .6&5,6&0,&52&21752//(5 )81&7,21$/'(6&5,37,21 7KH.6&,&EXVFRQWUROOHULVWKHPDVWHURIWKHVHULDO,&EXV8VLQJDSUHVFDOHUUHJLVWHU\RXFDQSURJUDP WKHVHULDOFORFNIUHTXHQF\WKDWLVVXSSOLHGWRWKH,&EXVFRQWUROOHU7KHVHULDOFORFNIUHTXHQF\LVFDOFXODWHGDV IROORZV 0&/.uSUHVFDOHUUHJLVWHUYDOXH 7RLQLWLDOL]HWKHVHULDO,&EXVWKHSURJUDPPHUVHQGVD6WDUWFRGHE\ZULWLQJWRELWV>@RIWKHFRQWUROVWDWXV UHJLVWHU,,&&217KHEXVFRQWUROOHUWKHQVHQGVWKHELWVODYHDGGUHVVDQGDUHDGZULWHFRQWUROELWWKURXJKVKLIW EXIIHUUHJLVWHU7KHUHFHLYHUVHQGVDQDFNQRZOHGJHE\SXOOLQJWKH6'$OLQHIURP+LJKWR/RZGXULQJDPDVWHU6&/ SXOVH 7RFRQWLQXHWKHGDWDZULWHRSHUDWLRQ\RXPXVWVHWWKH%)ELWLQWKHFRQWUROVWDWXVUHJLVWHUDQGWKHQZULWHWKHGDWDWR WKH6KLIWEXIIHUUHJLVWHU:KHQHYHUWKHVKLIWEXIIHUUHJLVWHULVUHDGRUZULWWHQWKH%)ELWLVFOHDUHGDXWRPDWLFDOO\)RU WKHFRQVHFXWLYHUHDGZULWHRSHUDWLRQV\RXPXVWVHWWKH$&.ELWLQWKHFRQWUROVWDWXVUHJLVWHU )RUUHDGRSHUDWLRQV\RXFDQUHDGWKHGDWDDIWHU\RXKDYHVHWWKH%)ELWLQWKHFRQWUROVWDWXVUHJLVWHU7RVLJQDOWKH HQGRIWKHUHDGRSHUDWLRQ\RXFDQUHVHWWKH$&.ELWWRLQIRUPWKHUHFHLYHUWUDQVPLWWHUZKHQWKHODVWE\WHLVWREH ZULWWHQUHDG )ROORZLQJDUHDGZULWHRSHUDWLRQ\RXVHW,,&&21>@WRWRJHQHUDWHD6WRSFRGH,I\RXZDQWWRFRPSOHWH DQRWKHUGDWDWUDQVIHUEHIRUHLVVXLQJWKH6WRSFRGH\RXFDQVHQGWKH6WDUWFRGHXVLQJWKH5HSHDW6WDUWFRPPDQG ZLWK,,&&21>@ :KHQWKHVODYHDGGUHVVDQGUHDGZULWHFRQWUROELWKDYHEHHQVHQWDQGZKHQWKHUHFHLYH DFNQRZOHGJHKDVEHHQLVVXHGWRFRQWURO6&/WLPLQJWKHGDWDWUDQVIHULVLQLWLDWHG .6&5,6&0,&52&21752//(5 ,&%86&21752//(5 ,&%86&21&(376 %DVLF2SHUDWLRQ 7KH,&EXVKDVWZRZLUHVDVHULDOGDWDOLQH6'/DQGDVHULDOFORFNOLQH6&/WRFDUU\LQIRUPDWLRQEHWZHHQWKH ,&VFRQQHFWHGWRWKHEXV(DFK,&LVUHFRJQL]HGE\DXQLTXHDGGUHVVDQGFDQRSHUDWHDVHLWKHUDWUDQVPLWWHURU UHFHLYHUGHSHQGLQJRQWKHIXQFWLRQRIWKHVSHFLILF,&V 7KH,&EXVLVDPXOWLPDVWHUEXV7KLVPHDQVWKDWPRUHWKDQRQH,&ZKLFKLVFDSDEOHRIFRQWUROOLQJWKHEXVFDQEH FRQQHFWHGWRLW'DWDWUDQVIHUVSURFHHGDVIROORZV &DVH$PDVWHU,&ZDQWVWRVHQGGDWDWRDQRWKHU,&VODYH 0DVWHUDGGUHVVHVVODYH 0DVWHUVHQGVGDWDWRWKHVODYHPDVWHULVWUDQVPLWWHUVODYHLVUHFHLYHU 0DVWHUWHUPLQDWHVWKHGDWDWUDQVIHU &DVH$PDVWHU,&ZDQWVWRUHFHLYHLQIRUPDWLRQIURPDQRWKHU,&VODYH 0DVWHUDGGUHVVHVVODYH 0DVWHUUHFHLYHVGDWDIURPWKHVODYHPDVWHULVUHFHLYHUVODYHLVWUDQVPLWWHU 0DVWHUWHUPLQDWHVWKHGDWDWUDQVIHU (YHQLQ&DVHWKHPDVWHU,&PXVWJHQHUDWHWKHWLPLQJVLJQDOVDQGWHUPLQDWHWKHGDWDWUDQVIHU ,IWZRRUPRUHPDVWHUVWU\WRSXWLQIRUPDWLRQVLPXOWDQHRXVO\RQWRWKHEXVWKHILUVWPDVWHUWRLVVXHDZKHQWKH RWKHULVVXHVDZLOOORVHWKHEXVDUELWUDWLRQ7KHFORFNVLJQDOVXVHGIRUDUELWUDWLRQDUHDV\QFKURQL]HG FRPELQDWLRQRIWKHFORFNVJHQHUDWHGE\WKHEXVPDVWHUVXVLQJWKHZLUHG$1'FRQQHFWLRQWRWKH6&/OLQH 7KHPDVWHU,&LVDOZD\VUHVSRQVLEOHIRUJHQHUDWLQJWKHFORFNVLJQDOVRQWKH,&EXV%XVFORFNVLJQDOVIURPD PDVWHUFDQRQO\EHDOWHUHGE\DVORZVODYH,&ZKLFKVWUHWFKHVWKHVLJQDOE\WHPSRUDULO\KROGLQJWKHFORFNOLQH /RZRUE\DQRWKHUPDVWHU,&GXULQJDUELWUDWLRQ *HQHUDO&KDUDFWHULVWLFV %RWK6'$DQG6&/DUHELGLUHFWLRQDOOLQHVZKLFKDUHFRQQHFWHGWRDSRVLWLYHVXSSO\YROWDJHWKURXJKDSXOOXS UHVLVWRU :KHQWKH,&EXVLVIUHHWKH6'$DQG6&/OLQHVDUHERWK+LJKOHYHO7KHRXWSXWVWDJHVRI, &LQWHUIDFHV FRQQHFWHGWRWKHEXVKDYHDQRSHQGUDLQRURSHQFROOHFWRUWRSHUIRUPWKHZLUHG$1'IXQFWLRQ'DWDRQWKH, &EXV FDQEHWUDQVIHUUHGDWDUDWHXSWR.ELWVV7KHQXPEHURILQWHUIDFHVWKDWFDQEHFRQQHFWHGWRWKHEXVLVVROHO\ GHSHQGHQWRQWKHOLPLWLQJEXVFDSDFLWDQFHRIS) %LW7UDQVIHUV 'XHWRWKHYDULHW\RIGLIIHUHQW,&V&0261026DQG,/IRUH[DPSOHZKLFKFDQEHFRQQHFWHGWRWKH,&EXV WKHOHYHOVRIORJLF]HUR/RZDQGORJLFRQH+LJKDUHQRWIL[HGDQGGHSHQGRQWKHDVVRFLDWHGOHYHORI9''2QH FORFNSXOVHLVJHQHUDWHGIRUHDFKGDWDELWWKDWLVWUDQVIHUUHG ,&%86&21752//(5 .6&5,6&0,&52&21752//(5 'DWD9DOLGLW\ 7KHGDWDRQWKH6'$OLQHPXVWEHVWDEOHGXULQJWKH+LJKSHULRGRIWKHFORFN7KH+LJKRU/RZVWDWHRIWKHGDWDOLQH FDQRQO\FKDQJHZKHQFORFNVLJQDORQWKH6&/OLQHLV/RZ 6WDUWDQG6WRS&RQGLWLRQV 6WDUWDQG6WRSFRQGLWLRQVDUHDOZD\VJHQHUDWHGE\WKHPDVWHU7KHEXVLVFRQVLGHUHGWREHEXV\DIWHUWKH6WDUW FRQGLWLRQLVJHQHUDWHG7KHEXVLVFRQVLGHUHGWREHIUHHDJDLQZKHQDEULHIWLPHLQWHUYDOKDVHODSVHGIROORZLQJWKH 6WRSFRQGLWLRQ 6WDUWFRQGLWLRQD+LJKWR/RZWUDQVLWLRQRIWKH6'$OLQHZKLOH6&/LV+LJK 6WRSFRQGLWLRQD/RZWR+LJKWUDQVLWLRQRIWKH6'$OLQHZKLOH6&/LV+LJK 6'$ 6&/ 6 3 6WDUW $GGUHVV 5: &RQGLWLRQ $&. '$7$ $&. '$7$ $&. 6WRS &RQGLWLRQ )LJXUH6WDUWDQG6WRS&RQGLWLRQV .6&5,6&0,&52&21752//(5 ,&%86&21752//(5 '$7$75$16)(523(5$7,216 'DWD%\WH)RUPDW (YHU\GDWDE\WHWKDWLVSXWRQWKH6'$OLQHPXVWEHELWVORQJ7KHQXPEHURIE\WHVWKDWFDQEHWUDQVPLWWHGSHU WUDQVIHULVXQOLPLWHG(DFKE\WHPXVWEHIROORZHGE\DQDFNQRZOHGJHELW'DWDLVWUDQVIHUUHG06%ILUVW ,IWKHUHFHLYHUFDQQRWUHFHLYHDQRWKHUFRPSOHWHE\WHRIGDWDXQWLOLWKDVSHUIRUPHGVRPHRWKHUIXQFWLRQVXFKDV VHUYLFLQJDQLQWHUQDOLQWHUUXSWLWFDQKROGWKHFORFNOLQH6&//RZWRIRUFHWKHWUDQVPLWWHULQWRDZDLWVWDWH7KHGDWD WUDQVIHUWKHQFRQWLQXHVZKHQWKHUHFHLYHULVUHDG\IRUDQRWKHUE\WHRIGDWDDQGUHOHDVHVWKH6&/OLQH $FNQRZOHGJH3URFHGXUH 'DWDWUDQVIHUZLWKDFNQRZOHGJHLVREOLJDWRU\7KHDFNQRZOHGJHUHODWHGFORFNSXOVHVPXVWEHJHQHUDWHGE\WKHEXV PDVWHU7KHWUDQVPLWWHUUHOHDVHVWKH6'$OLQH+LJKGXULQJWKHDFNQRZOHGJHFORFNSXOVH 7KHUHFHLYHUPXVWSXOOGRZQWKH6'$OLQHGXULQJWKHDFNQRZOHGJHSXOVHVRWKDWLWUHPDLQVVWDEOH/RZGXULQJWKH +LJKSHULRGRIWKLVFORFNSXOVH 8VXDOO\DUHFHLYHUZKLFKKDVEHHQDGGUHVVHGLVREOLJHGWRJHQHUDWHDQDFNQRZOHGJHDIWHUHDFKE\WHLVUHFHLYHG :KHQDVODYHUHFHLYHUGRHVQRWDFNQRZOHGJHIURPWKHVODYHDGGUHVVWKHVODYHPXVWOHDYHWKHGDWDOLQH+LJK7KH PDVWHUFDQWKHQJHQHUDWHD6WRSFRQGLWLRQWRDERUWWKHWUDQVIHU ,IDVODYHUHFHLYHUDFNQRZOHGJHVWKHVODYHDGGUHVVEXWODWHULQWKHWUDQVIHUFDQQRWUHFHLYHDQ\PRUHGDWDE\WHV WKHPDVWHUPXVWDJDLQDERUWWKHWUDQVIHU7KLVLVLQGLFDWHGE\WKHVODYHQRWJHQHUDWLQJWKHDFNQRZOHGJHRQWKHILUVW E\WHWRIROORZ7KHVODYHOHDYHVWKHGDWDOLQH+LJKDQGWKHPDVWHUJHQHUDWHVWKH6WRSFRQGLWLRQ ,IDPDVWHUUHFHLYHULVLQYROYHGLQDWUDQVIHULWPXVWVLJQDOWKHHQGRIGDWDWRWKHVODYHWUDQVPLWWHUE\QRWJHQHUDWLQJ DQDFNQRZOHGJHRQWKHODVWE\WHWKDWZDVFORFNHGRXWRIWKHVODYH7KHVODYHWUDQVPLWWHUPXVWWKHQUHOHDVHWKHGDWD OLQHWROHWWKHPDVWHUJHQHUDWHWKH6WRSFRQGLWLRQ ,&%86&21752//(5 .6&5,6&0,&52&21752//(5 'DWD7UDQVIHU)RUPDW 'DWDWUDQVIHUVXVHVWKHIRUPDWVKRZQLQ)LJXUH$IWHUWKH6WDUWFRQGLWLRQKDVEHHQJHQHUDWHGDELWVODYH DGGUHVVLVVHQW7KHHLJKWKELWLVDGDWDGLUHFWLRQELW5:$GLUHFWLRQELWLQGLFDWHVDWUDQVPLVVLRQ:ULWHDQGD LQGLFDWHVDUHTXHVWIRUGDWD5HDG $GDWDWUDQVIHULVDOZD\VWHUPLQDWHGE\D6WRSFRQGLWLRQZKLFKLVJHQHUDWHGE\WKHPDVWHU+RZHYHULIDPDVWHUVWLOO ZLVKHVWRFRPPXQLFDWHRQWKHEXVLWFDQJHQHUDWHDQRWKHU6WDUWFRQGLWLRQDQGDGGUHVVDQRWKHUVODYHZLWKRXWILUVW JHQHUDWLQJD6WRSFRQGLWLRQ7KLVIHDWXUHVXSSRUWVWKHXVHRIYDULRXVFRPELQDWLRQVRIUHDGZULWHIRUPDWVIRUGDWD WUDQVIHUV 0XOWLSOH%\WH6ODYH5HFHLYHU)RUPDW 6 6/$9($''5(66 : $ '$7$ELWV $ '$7$ $ '$7$0 $ 3 0XOWLSOH%\WH6ODYH7UDQVPLWWHU)RUPDW 6 6/$9($''5(66 5 $ '$7$ELWV $ '$7$ $ '$7$0 $ 3 127( 66WDUW ::ULWHELWYDOXHLV 55HDGELWYDOXHLV 36WRS $$FNQRZOHGJH7KH$&.LVILUVWVHQWWRWKHVODYH$IWHUZDUGVWKHGLUHFWLRQ GHSHQGVRQWKHGDWDWUDQVIHUGLUHFWLRQ,QRWKHUZRUGVLIWKHPDVWHUUHDGVWKH GDWDLWVHQGVWKH$&. )LJXUH'DWD7UDQVIHU)RUPDW .6&5,6&0,&52&21752//(5 ,&%86&21752//(5 ,&%86$''5(66,1* 7KHDGGUHVVLQJSURFHGXUHIRUWKH,&EXVLVVXFKWKDWWKHILUVWE\WHDIWHUWKH6WDUWFRQGLWLRQGHWHUPLQHVZKLFKVODYH WKHPDVWHUZLOOVHOHFW8VXDOO\WKLVILUVWE\WHLPPHGLDWHO\IROORZVWKH6WDUWSURFHGXUH $QH[FHSWLRQLVWKHJHQHUDOFDOODGGUHVVZKLFKFDQDGGUHVVDOO,&VVLPXOWDQHRXVO\:KHQWKLVDGGUHVVLVXVHGDOO ,&VVKRXOGLQWKHRU\UHVSRQGZLWKDQDFNQRZOHGJH+RZHYHU,&VFDQDOVREHPDGHWRLJQRUHWKLVDGGUHVV7KH VHFRQGE\WHRIWKHJHQHUDOFDOODGGUHVVWKHQGHILQHVWKHDFWLRQWREHWDNHQ 'HILQLWLRQRI%LWVLQWKH)LUVW'DWD%\WH 7KHILUVWVHYHQELWVRIWKHILUVWGDWDE\WHPDNHXSWKHVODYHDGGUHVV7KHHLJKWKELWLVWKH/6%RUGLUHFWLRQELWZKLFK GHWHUPLQHVWKHGLUHFWLRQ5:RIWKHPHVVDJH :KHQDQDGGUHVVLVVHQWHDFK,&RQWKHEXVFRPSDUHVWKHILUVWELWVUHFHLYHGIROORZLQJ6WDUWFRQGLWLRQZLWKLWV RZQDGGUHVV,IWKHDGGUHVVHVPDWFKWKH,&FRQVLGHUVLWVHOIDGGUHVVHGE\WKHPDVWHUDVDVODYHUHFHLYHURUDVODYH WUDQVPLWWHU *HQHUDO&DOO$GGUHVV 7KHJHQHUDOFDOODGGUHVVFDQEHXVHGWRDGGUHVVHYHU\,&WKDWFRQQHFWHGWRWKH,&EXV+RZHYHULIDQ,&GRHV QRWQHHGDQ\RIWKHGDWDVXSSOLHGZLWKLQWKHJHQHUDOFDOOVWUXFWXUHLWFDQLJQRUHWKLVDGGUHVVE\QRWDFNQRZOHGJLQJ LW ,IDQ,&GRHVUHTXLUHGDWDIURPDJHQHUDOFDOODGGUHVVLWFDQWKHQDFNQRZOHGJHWKLVDGGUHVVDQGEHKDYHDVDVODYH UHFHLYHU7KHVHFRQGDQGIROORZLQJE\WHVZLOOEHDFNQRZOHGJHGE\HYHU\VODYHUHFHLYHUFDSDEOHRIKDQGOLQJWKLV GDWD$VODYHZKLFKFDQQRWSURFHVVRQHRIWKHVHE\WHVPXVWLJQRUHLWE\QRWDFNQRZOHGJLQJ7KHPHDQLQJRIWKH JHQHUDOFDOODGGUHVVLVDOZD\VVSHFLILHGLQWKHVHFRQGE\WH 6WDUW%\WH (YHU\GDWDWUDQVIHULVSUHFHGHGE\DVWDUWSURFHGXUH $6WDUWFRQGLWLRQ6 $VWDUWE\WH $QDFNQRZOHGJH$&.FORFNSXOVHDQG $UHSHDWHG6WDUWFRQGLWLRQ6U $IWHUWKH6WDUWFRQGLWLRQ6KDVEHHQWUDQVPLWWHGE\DPDVWHUZKLFKUHTXLUHVEXVDFFHVVWKHVWDUWE\WH LVWUDQVPLWWHG$QRWKHU,&FDQWKHUHIRUHVDPSOHWKH6'$OLQHDWDORZVDPSOLQJUDWHXQWLORQHRIWKH VHYHQ]HURVLQWKHVWDUWE\WHLVGHWHFWHG$IWHULWGHWHFWVWKLV/RZOHYHORQWKH6'$OLQHWKH,&FDQVZLWFKWRD KLJKHUVDPSOLQJUDWHWRILQGWKHUHSHDWHG6WDUWFRQGLWLRQ6UZKLFKLVWKHQXVHGIRUV\QFKURQL]DWLRQ$KDUGZDUH UHFHLYHUZLOOUHVHWXSRQUHFHLSWRIWKHUHSHDWHG6WDUWFRQGLWLRQ6UDQGZLOOWKHUHIRUHLJQRUHWKHVWDUWE\WH $QDFNQRZOHGJHUHODWHGFORFNSXOVHLVJHQHUDWHGDIWHUWKHVWDUWE\WH7KLVLVGRQHRQO\WRFRQIRUPZLWKWKHE\WH KDQGOLQJIRUPDWXVHGRQWKHEXV1R,&LVDOORZHGWRDFNQRZOHGJHWKH6WDUWE\WH ,&%86&21752//(5 .6&5,6&0,&52&21752//(5 ,&%8663(&,$/5(*,67(56 7KH,&EXVFRQWUROOHUKDVWKUHHVSHFLDOUHJLVWHUVDFRQWUROVWDWXVUHJLVWHU,,&&21DSUHVFDOHUUHJLVWHU,,&36 DQGDVKLIWEXIIHUUHJLVWHU,,&%8) &RQWURO6WDWXV5HJLVWHU,,&&21 7KHFRQWUROVWDWXVUHJLVWHUIRUWKH,&EXV,,&&21LVGHVFULEHGLQ7DEOH 7DEOH&RQWURO6WDWXU5HJLVWHU,,&&21 5HJLVWHU ,,&&21 7DEOH,,&&215HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH %XIIHUIODJ%) 'HVFULSWLRQ 7KH%)ELWLVVHWZKHQWKHEXIIHULVHPSW\LQWUDQVPLWPRGHRUZKHQ WKHEXIIHULVIXOOLQUHFHLYHPRGH7RFOHDUWKHEXIIHU\RXZULWHD WRWKLVELW7KH%)ELWLVFOHDUHGDXWRPDWLFDOO\ZKHQHYHUWKH,,&%8) UHJLVWHULVZULWWHQRUUHDG,I\RXVHW%)ELWWRRQHWKH,&EXVLV VWRSSHG7RDFWLYDWH,&EXV\RXVKRXOGFOHDUWKH%)ELWWR]HUR 6HWWLQJWKHLQWHUUXSWHQDEOHELWWRHQDEOHVWKH,&EXVLQWHUUXSW 7KH/5%ELWLVUHDGRQO\,WKROGVWKHYDOXHRIWKHODVWUHFHLYHGELW RYHUWKH,&EXV1RUPDOO\WKLVELWZLOOEHWKHYDOXHRIWKHVODYH DFNQRZOHGJHPHQW7RFKHFNIRUVODYHDFNQRZOHGJHPHQW\RXWHVW WKH/5% 7KH$&.ELWLVQRUPDOO\VHWWR7KLVFDXVHVWKH,&EXV FRQWUROOHUWRVHQGDQDFNQRZOHGJHDXWRPDWLFDOO\DIWHUHDFKE\WH 7KLVELWPXVWEHZKHQWKH,&EXVFRQWUROOHULVRSHUDWLQJLQ UHFHLYHUPRGHDQGUHTXLUHVQRIXUWKHUGDWDWREHUHFHLYHGIURPWKH VODYHWUDQVPLWWHU7KLVFDXVHVDQHJDWLYHDFNQRZOHGJHRQWKH, & EXVZKLFKKDOWVIXUWKHUUHFHSWLRQIURPWKHVODYHGHYLFH 7KHVHELWVFRQWUROWKHJHQHUDWLRQRIWKH6WDUW6WRSDQGUHSHDW6WDUW FRQGLWLRQV QRHIIHFW 6WDUW 6WRSDQG UHSHDW6WDUW 7KLVELWLVDUHDGRQO\IODJWKDWLQGLFDWHVZKHQWKH,&EXVLVLQXVH $LQGLFDWHVWKDWWKHEXVLVEXV\7KLVELWLVVHWRUFOHDUHGE\D 6WDUWRU6WRSFRQGLWLRQUHVSHFWLYHO\ ,ILVZULWWHQWRWKH5HVHWELWWKH,&EXVFRQWUROOHULVUHVHWWRLWV LQLWLDOVWDWH 1RWDSSOLFDEOH 2IIVHW $GGUHVV [I 5: 5: 'HVFULSWLRQ &RQWUROVWDWXVUHJLVWHU 5HVHW 9DOXH [ >@ >@ ,QWHUUXSWHQDEOH,(1 /DVWUHFHLYHGELW/5% >@ $FNQRZOHGJHHQDEOH $&. >@ &21'&21' >@ %XVEXV\%86< >@ >@ 5HVHW 5HVHUYHG .6&5,6&0,&52&21752//(5 ,&%86&21752//(5 5(6(59(' 5 & & % ( 2 2 $ / , % 8 6 1 1 & 5 ( ) 6 ( ' ' . % 1 < 7 >@%XIIHU)ODJ%) $XWRPDWLFDOO\FOHDUHGZKHQWKH,,&%8)UHJLVWHULVZULWWHQ RUUHDG7RPDQXDOO\FOHDUWKH%)ZULWH $XWRPDWLFDOO\VHWZKHQWKHEXIIHULVHPSW\LQWUDQVPLW PRGHRUZKHQWKHEXIIHULVIXOOLQUHFHLYHPRGH >@,QWHUUXSWHQDEOH,(1 'LVDEOH (QDEOHDQLQWHUUXSWLVJHQHUDWHGLIWKH%)ELWLV >@/DVWUHFHLYHGELW/5% 8VHWKLVUHDGRQO\VWDWXVELWWRFKHFNIRU$&.VLJQDOVIURPWKH UHFHLYHUVODYHRUWRPRQLWRU6'$RSHUDWLRQRI6'$ZKHQ ZULWLQJWR,,&&21>@IRUUHSHDWHGVWDUWV 7KHPRVWUHFHQW6'$LV/RZ$&.LVUHFHLYHG 7KHPRVWUHFHQW6'$LV+LJK$&.QRWUHFHLYHG >@$FNQRZOHGJHHQDEOH$&. &RQWUROVJHQHUDWLRQRIDQ $&.VLJQDOLQUHFHLYHPRGH 'RQRWJHQHUDWHDQ$&.DWWK6&/1RPRUHUHFHLYHG GDWDLVUHTXLUHGIURPWKHVODYH *HQHUDWHDQ$&.VLJQDODWWK6&/ >@&21'DQG&21' *HQHUDWHDEXVFRQWUROFRQGLWLRQVXFKDV6WDUWRU6WRS 1RHIIHFW *HQHUDWH6WDUWFRQGLWLRQ *HQHUDWH6WRSFRQGLWLRQ 6&/ZLOOEHUHOHDVHGWR+LJKOHYHOWRJHQHUDWHUHSHDWHG 6WDUWFRQGLWLRQV >@%XVEXV\%86< 'DWDWUDQVPLVVLRQLVLQSURJUHVVRQWKH,,&EXV %XVLVFXUUHQWO\QRWLQXVH1RWEXV\ %XVLVLQXVH%XV\ >@5HVHW 1RUPDO 5HVHWWKH,,&EXVFRQWUROOHU >@5HVHUYHG )LJXUH,&&RQWURO6WDWXV5HJLVWHU ,&%86&21752//(5 .6&5,6&0,&52&21752//(5 6KLIW%XIIHU5HJLVWHU,,&%8) 7KHVKLIWEXIIHUUHJLVWHUIRUWKH,&EXVLVGHVFULEHGLQ7DEOH 7DEOH,,&%8)5HJLVWHU 5HJLVWHU ,,&%8) 2IIVHW $GGUHVV [I 5: 5: 'HVFULSWLRQ 6KLIWEXIIHUUHJLVWHU 5HVHW 9DOXH 8QGHILQHG 7DEOH,,&%8)5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ 'DWD %LW1DPH 'HVFULSWLRQ 7KLVGDWDILHOGDFWVDVVHULDOVKLIWUHJLVWHUDQGUHDGEXIIHUIRU LQWHUIDFLQJWRWKH,&EXV$OOUHDGDQGZULWHRSHUDWLRQVWRIURPWKH ,&EXVDUHGRQHYLDWKLVUHJLVWHU7KH,,&%8)UHJLVWHULVD FRPELQDWLRQRIDVKLIWUHJLVWHUDQGDGDWDEXIIHUELWSDUDOOHOGDWDLV DOZD\VZULWWHQWRWKHVKLIWUHJLVWHUDQGUHDGIURPWKHGDWDEXIIHU ,&EXVGDWDLVDOZD\VVKLIWHGLQRURXWRIWKHVKLIWUHJLVWHU 1RWDSSOLFDEOH >@ 5HVHUYHG 3UHVFDOHU5HJLVWHU,,&36 7KHSUHVFDOHUUHJLVWHUIRUWKH,&EXVLVGHVFULEHGLQ7DEOH 7DEOH,,&365HJLVWHU 5HJLVWHU ,,&36 2IIVHW 5HJLVWHU [I 5: 5: 'HVFULSWLRQ 3UHVFDOHUUHJLVWHU 5HVHW 9DOXH [ 7DEOH,,&635HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 3UHVFDOHUYDOXH 'HVFULSWLRQ 7KLVSUHVFDOHUYDOXHLVXVHGWRJHQHUDWHWKHVHULDO, &EXVFORFN 7KHV\VWHPFORFNLVGLYLGHGE\uSUHVFDOHUYDOXHWR PDNHWKHVHULDO,&FORFN,IWKHSUHVFDOHUYDOXHLV]HURWKHV\VWHP FORFNLVWKHQGLYLGHGE\WRPDNHWKHVHULDO,&FORFN 1RWDSSOLFDEOH >@ 5HVHUYHG .6&5,6&0,&52&21752//(5 ,&%86&21752//(5 3UHVFDOHU&RXQWHU5HJLVWHU,,&&17 7KHSUHVFDOHUFRXQWHUUHJLVWHUIRUWKH,&EXVLVGHVFULEHGLQ7DEOH 7DEOH,,&&175HJLVWHU 5HJLVWHU ,,&&17 7DEOH,,&&175HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ %LW1DPH &RXQWHUYDOXH 5HVHUYHG 'HVFULSWLRQ 7KLVELWYDOXHLVWKHYDOXHRIWKHSUHVFDOHUFRXQWHU,WLVUHDGLQ WHVWPRGHRQO\WRFKHFNWKHFRXQWHUVFXUUHQWYDOXH 1RWDSSOLFDEOH 2IIVHW 5HJLVWHU [IF 5: 5: 'HVFULSWLRQ 3UHVFDOHUFRXQWHUUHJLVWHU 5HVHW 9DOXH [ ,&%86&21752//(5 .6&5,6&0,&52&21752//(5 127(6 .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 (7+(51(7&21752//(5 7KH.6&KDVDQ(WKHUQHWFRQWUROOHUZKLFKRSHUDWHVDWHLWKHU0ELWVRU0ELWVSHUVHFRQGLQKDOI GXSOH[RUIXOOGXSOH[PRGH,QKDOIGXSOH[PRGHWKHFRQWUROOHUVXSSRUWVWKH,(((&DUULHU6HQVH0XOWLSOH $FFHVVZLWK&ROOLVLRQ'HWHFWLRQ&60$&'SURWRFRO,QIXOOGXSOH[PRGHLWVXSSRUWVWKH,(((0$&&RQWURO /D\HULQFOXGLQJWKH3DXVHRSHUDWLRQIRUIORZFRQWURO 7KH(WKHUQHWFRQWUROOHUV0$&OD\HUVXSSRUWVERWKWKH0HGLD,QGHSHQGHQW,QWHUIDFH0,,DQGWKH%XIIHUHG'0$ ,QWHUIDFH%',7KH0$&OD\HULWVHOIFRQVLVWVRIWKHUHFHLYHDQGWKHWUDQVPLWEORFNVDIORZFRQWUROEORFND&RQWHQW $GGUHVVDEOH0HPRU\&$0IRUVWRULQJQHWZRUNDGGUHVVHVDQGDQXPEHURIFRPPDQGVWDWXVDQGHUURUFRXQWHU UHJLVWHUV 7KH0,,VXSSOLHVWKHWUDQVPLWDQGUHFHLYHFORFNVRI0+]IRU0ELWVRSHUDWLRQRU0+]DWWKH0ELWV VSHHG7KH0,,FRQIRUPVWRWKH,62,(&VWDQGDUGVIRUDPHGLDLQGHSHQGHQWOD\HUZKLFKVHSDUDWHVSK\VLFDO OD\HULVVXHVIURPWKH0$&OD\HU %'0$6%86,) %'0$7[ %XIIHU &RQWUROOHU 6 < 6 7 ( 0 % 8 6 %XV$UELWHU &RQWUROOHU %'0$5[ %XIIHU ZRUGV 0$& 0$&7[ %XIIHU &RQWUROOHU 3UHDPEOH -DP3DG &5& *HQHUDWRU 0$&5[ %XIIHU &RQWUROOHU )ORZ &RQWUROOHU 3+<6,&$/ /$<(5 %'0$7[ %XIIHU ZRUGV 0$&7[ %XIIHU E\WHV % ' , %'0$5[ %XIIHU &RQWUROOHU 0$&5[ %XIIHU E\WHV &$0 &RQWHQWV 0HPRU\ ZRUGV %'0$&RQWURO DQG6WDWXV 5HJLVWHU $GGUHVV &$0 ,QWHUIDFHDQG &RPSDUDWRU 0 , , 0 E S V : L U H 6WDWLRQ 0DQDJHU 0', &5& &KHFNHU 0$&&RQWURO DQG6WDWXV 5HJLVWHU )LJXUH(WKHUQHW6\VWHP)ORZ&RQWURO (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 )($785(6$1'%(1(),76 7KHPRVWLPSRUWDQWIHDWXUHVDQGEHQHILWVRIWKH.6&(WKHUQHWFRQWUROOHUDUHDVIROORZV &RVWHIIHFWLYHFRQQHFWLRQWRDQH[WHUQDO5,&(WKHUQHWEDFNERQH %XIIHUHG'0$%'0$HQJLQHXVLQJ%XUVWPRGH %'0$7[5[EXIIHUVE\WHVE\WHV 0$&7[5[),)2VE\WHVE\WHVWRVXSSRUWUHWUDQVPLWDIWHUFROOLVLRQZLWKRXW'0$UHTXHVWDQGWRKDQGOH '0$ODWHQF\ 'DWDDOLJQPHQWORJLF (QGLDQWUDQVODWLRQ 6XSSRUWIRUROGDQGQHZPHGLDFRPSDWLEOHZLWKH[LVWLQJ0ELWVQHWZRUNV 0ELWVRU0ELWVVRSHUDWLRQWRLQFUHDVHSULFHSHUIRUPDQFHRSWLRQVDQGWRVXSSRUWSKDVHGFRQYHUVLRQV )XOO,(((FRPSDWLELOLW\IRUH[LVWLQJDSSOLFDWLRQV 0HGLD,QGHSHQGHQW,QWHUIDFH0,,RUZLUHLQWHUIDFH 6WDWLRQ0DQDJHPHQW67$VLJQDOLQJIRUH[WHUQDOSK\VLFDOOD\HUFRQILJXUDWLRQDQGOLQNQHJRWLDWLRQ 2QFKLS&$0DGGUHVVHV )XOOGXSOH[PRGHIRUGRXEOHGEDQGZLGWK 3DXVHRSHUDWLRQKDUGZDUHVXSSRUWIRUIXOOGXSOH[IORZFRQWURO /RQJSDFNHWPRGHIRUVSHFLDOL]HGHQYLURQPHQWV 6KRUWSDFNHWPRGHIRUIDVWWHVWLQJ 3$'JHQHUDWLRQIRUHDVHRISURFHVVLQJDQGUHGXFHGSURFHVVLQJWLPH .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 0$&)81&7,21%/2&.6 7KHPDMRUIXQFWLRQEORFNVRIWKH(WKHUQHWFRQWUROOHUV0$&OD\HUDUHGHVFULEHGLQ7DEOHDQG)LJXUH 7DEOH0$&)XQFWLRQ%ORFN'HVFULSWLRQV )XQFWLRQ%ORFN 0HGLD,QGHSHQGHQW ,QWHUIDFH0,, 7UDQVPLWEORFN 'HVFULSWLRQ 7KHLQWHUIDFHEHWZHHQWKHSK\VLFDOOD\HUDQGWKHWUDQVPLWDQGUHFHLYHEORFNV 0RYHVWKHRXWJRLQJGDWDIURPWKHWUDQVPLWEXIIHUWRWKH0,,7KHWUDQVPLWEORFN LQFOXGHVFLUFXLWVIRUJHQHUDWLQJWKH&5&FKHFNLQJSDULW\DQGJHQHUDWLQJSUHDPEOH RUMDP7KHWUDQVPLWEORFNDOVRKDVWLPHUVIRUEDFNRIIDIWHUFROOLVLRQDQGIRUWKH LQWHUIUDPHJDSWKHIROORZVDWUDQVPLVVLRQ $FFHSWVLQFRPLQJGDWDIURPWKH0,,DQGVWRUHVLWLQWKHUHFHLYH),)27KHUHFHLYH EORFNKDVORJLFIRUFRPSXWLQJDQGFKHFNLQJWKH&5&YDOXHJHQHUDWLQJSDULW\IRU GDWDIURPWKH0,,DQGFKHFNLQJPLQLPXPDQGPD[LPXPSDFNHWOHQJWKV7KH UHFHLYHEORFNDOVRKDVD&RQWHQW$GGUHVVDEOH0HPRU\&$0EORFNZKLFKSURYLGHV IRUDGGUHVVORRNXSDQGIRUDFFHSWDQFHRUUHMHFWLRQIRUSDFNHWVEDVHGRQWKHLU GHVWLQDWLRQDGGUHVV 5HFRJQL]HV0$&FRQWUROSDFNHWVDQGVXSSRUWVWKH3DXVHRSHUDWLRQIRUIXOOGXSOH[ OLQNV7KHIORZFRQWUROEORFNDOVRVXSSRUWVJHQHUDWLRQRI3DXVHSDFNHWVDQG SURYLGHVWLPHUVDQGFRXQWHUVIRUSDXVHFRQWURO &RQWUROVSURJUDPPDEOHRSWLRQVLQFOXGLQJWKHHQDEOLQJRUGLVDEOLQJRIVLJQDOVZKLFK QRWLI\WKHV\VWHPZKHQFRQGLWLRQVRFFXU7KHVWDWXVUHJLVWHUVKROGLQIRUPDWLRQIRU HUURUKDQGOLQJVRIWZDUHDQGWKHHUURUFRXQWHUVDFFXPXODWHVWDWLVWLFDOLQIRUPDWLRQIRU QHWZRUNPDQDJHPHQWVRIWZDUH 3URYLGHVIRU0$&OD\HUWHVWLQJLQLVRODWLRQIURPWKH0,,DQGSK\VLFDOOD\HU 5HFHLYHEORFN )ORZFRQWUROEORFN 0$&FRQWUROFRPPDQG DQGVWDWXVUHJLVWHUV /RRSEDFNFLUFXLW (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7[B'%>@ 0$& 7UDQVPLW ),)2 E\WHV 7UDQVPLW%ORFN 3UHDPEOHDQG -DP*HQHUDWRU 3DGDQG&5& *HQHUDWRU 0$& /RRSEDFN 7['>@ 0 E V ,) 7['B %DFNRII DQG ,QWHUJDS 7LPHU % ' , 5[B'%>@ )ORZ&RQWURO 5['B 3DULW\&KHFN 0$& 5HFHLYH ),)2 E\WHV &5&DQG &$0)LOWHUV 5HFHLYH%ORFN 3DULW\ *HQHUDWRU 5['>@ 0 , , 0,,6WDWLRQ 0DQDJHU 0'& 0',2 0$&&RQWURODQG 6WDWXV5HJLVWHU )LJXUH0$&/D\HU)ORZ&RQWURO)XQFWLRQ%ORFNV .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 0(',$,1'(3(1'(17,17(5)$&(0,, 7UDQVPLWDQGUHFHLYHEORFNVERWKRSHUDWHXVLQJWKH0,,ZKLFKZDVGHYHORSHGE\WKH,(((7DVN)RUFHRQ 0ELWV(WKHUQHW7KLVLQWHUIDFHKDVWKHIROORZLQJFKDUDFWHULVWLFV 0HGLDLQGHSHQGHQFH 0XOWLYHQGRUSRLQWVRILQWHURSHUDELOLW\ 6XSSRUWVFRQQHFWLRQRI0$&OD\HUDQGSK\VLFDOOD\HUHQWLW\3+<GHYLFHV &DSDEOHRIVXSSRUWLQJERWK0ELWVDQG0ELWVGDWDUDWHV 'DWDDQGGHOLPLWHUVDUHV\QFKURQRXVWRFORFNUHIHUHQFHV 3URYLGHVLQGHSHQGHQWELWZLGHWUDQVPLWDQGUHFHLYHGDWDSDWKV 8VHV77/VLJQDOOHYHOVWKDWDUHFRPSDWLEOHZLWKFRPPRQGLJLWDO&026$6,&SURFHVVHV 6XSSRUWVFRQQHFWLRQRI3+<OD\HUDQG6WDWLRQ0DQDJHPHQW67$GHYLFHV 3URYLGHVDVLPSOHPDQDJHPHQWLQWHUIDFH &DSDEOHRIGULYLQJDOLPLWHGOHQJWKRIVKLHOGHGFDEOH 3+<6,&$//$<(5(17,7<3+< 7KHSK\VLFDOOD\HUHQWLW\RU3+<SHUIRUPVDOORIWKHGHFRGLQJHQFRGLQJRQLQFRPLQJDQGRXWJRLQJGDWD7KH PDQQHURIGHFRGLQJDQGHQFRGLQJ0DQFKHVWHUIRU%$6(7%%IRU%$6(;RU%7IRU%$6(7 GRHVQRWDIIHFWWKH0,,7KH0,,SURYLGHVWKHUDZGDWDLWUHFHLYHVVWDUWLQJZLWKWKHSUHDPEOHDQGHQGLQJZLWKWKH &5&7KH0,,H[SHFWVUDZGDWDIRUWUDQVPLVVLRQDOVRVWDUWLQJZLWKWKHSUHDPEOHDQGHQGLQJZLWKWKH&5&7KH 0$&OD\HUDOVRJHQHUDWHVMDPGDWDDQGWUDQVPLWVLWWRWKH3+< %8))(5(''0$,17(5)$&(%', 7KH%XIIHUHG'0$,QWHUIDFH%',VXSSRUWVUHDGDQGZULWHRSHUDWLRQVDFURVVWKHV\VWHPEXV7ZRHLJKWELWEXVHV WUDQVIHUGDWDZLWKRSWLRQDOSDULW\FKHFNLQJ7KHV\VWHPLQWHUIDFHLQLWLDWHVGDWDWUDQVIHUV7KH0$&OD\HUFRQWUROOHU UHVSRQGVZLWKDUHDG\VLJQDOWRDFFHSWGDWDIRUWUDQVPLVVLRQRUWRGHOLYHUGDWDZKLFKKDVEHHQUHFHLYHG$QHQGRI IUDPHVLJQDOLQGLFDWHVWKHERXQGDU\EHWZHHQSDFNHWV (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7+(0$&75$160,7%/2&. 7KH0$&WUDQVPLWEORFNLVUHVSRQVLEOHIRUWUDQVPLWWLQJGDWD,WFRPSOLHVZLWKWKH,(((6WDQGDUGIRU&DUULHU 6HQVH0XOWLSOH$FFHVVZLWK&ROOLVLRQ'HWHFWLRQ&60$&'SURWRFRO7KH0$&WUDQVPLWEORFNFRQVLVWVRIWKH IROORZLQJVHFWLRQV 7UDQVPLW),)2DQGFRQWUROOHUV 3UHDPEOHDQGMDPJHQHUDWRUV 3DGJHQHUDWRU 3DUDOOHO&5&JHQHUDWRU 7KUHVKROGORJLFDQGFRXQWHUV %DFNRIIDQGUHWUDQVPLWWLPHUV 7UDQVPLWVWDWHPDFKLQH )LJXUHVKRZVWKH0$&WUDQVPLWIXQFWLRQEORFNVLQGHWDLO 3$5,7< &+(&. 7[B'%>@ $1'3$5,7< 0$& 75$160,7 ),)2 [ 35($0%/($1' -$0*(1(5$725 7['>@ 0 , , $ 1 ' 0 % < 7 ( ,) 3$' *(1(5$725 7[BFON &5& *(1(5$725 75$160,7 67$7( 0$&+,1( &U6 7[BHU 7[BHQ &RO % ' , 7[B(2) 7[BZU 7[BUG\ :5,7(),)2 &21752//(5 $1'&2817(5 5($'),)2 &21752//(5 $1'&2817(5 7+5(6+2/' /2*,&$1' &2817(56 %$&.2))$1' 5(75$160,7 7,0(56 6\VBFON'20$,1 7[BFON'20$,1 )LJXUH0$&7UDQVPLW)XQFWLRQ%ORFNV .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 7UDQVPLW),)2DQG5HDG:ULWH&RQWUROOHUV 7KHWUDQVPLW),)2KDVDQE\WHGHSWK$QH[WUDELWLVDVVRFLDWHGZLWKHDFKGDWDE\WHIRUSDULW\FKHFNLQJ7KLV E\WHE\ELWVL]HDOORZVWKHILUVWE\WHVRIDGDWDSDFNHWWREHVWRUHGDQGUHWUDQVPLWWHGZLWKRXWIXUWKHUV\VWHP LQYROYHPHQWLQFDVHRIDFROOLVLRQ,IQRFROOLVLRQRFFXUVDQGWUDQVPLVVLRQLVXQGHUZD\WKHDGGLWLRQDOE\WHV KDQGOHV\VWHPODWHQF\DQGDYRLG),)2XQGHUUXQ :KHQWKHV\VWHPLQWHUIDFHKDVVHWWKHWUDQVPLWHQDEOHELWLQWKHDSSURSULDWHFRQWUROUHJLVWHUWKHWUDQVPLWVWDWH PDFKLQHUHTXHVWVGDWDIURPWKH%',7KHV\VWHPFRQWUROOHUWKHQIHWFKHVGDWDIURPWKHV\VWHPPHPRU\ 7KH),)2FRQWUROOHUVWRUHVGDWDLQWKHWUDQVPLW),)2XQWLOWKHWKUHVKROGIRUWUDQVPLWGDWDLVVDWLVILHG7KH),)2 FRQWUROOHUSDVVHVDKDQGVKDNLQJVLJQDOWRWKHWUDQVPLWVWDWHPDFKLQHLQGLFDWLQJWKDWVXIILFLHQWGDWDLVLQWKH),)2WR VWDUWWKHWUDQVPLWRSHUDWLRQ,IWKH),)2LVQRWIXOOWKH),)2FRQWUROOHULVVXHVDUHTXHVWWRWKH%',IRUPRUHGDWD7KH WUDQVPLWVWDWHPDFKLQHFRQWLQXHVWUDQVPLWWLQJGDWDXQWLOLWGHWHFWVWKHHQGRIIUDPHVLJQDOZKLFKVLJQDOVWKHODVW E\WH,WWKHQDSSHQGVWKHFDOFXODWHG&5&WRWKHHQGRIWKHGDWDXQOHVVWKH&5&WUXQFDWHELWLQWKHWUDQVPLWFRQWURO UHJLVWHULVVHW7KHSDFNHWWUDQVPLWELWLQWKHVWDWXVUHJLVWHULVVHWJHQHUDWLQJDQLQWHUUXSWLILWLVHQDEOHG 7KH),)2FRXQWHUVLQWKLVEORFNWKH:ULWHFRXQWHUDQGWKHWUDQVPLW),)2FRXQWHURIWKHWUDQVPLWVWDWHPDFKLQH WKH5HDGFRXQWHUFRRUGLQDWHWKHLUIXQFWLRQVEDVHGRQHDFKRWKHUVFRXQWYDOXHDOWKRXJKWKH\GRKDYHGLIIHUHQW FORFNVRXUFHV 7KH),)2FRQWUROOHUVWRUHVSDULW\ELWVZLWKWKHGDWDLQWKH),)2,WFKHFNVIRUSDULW\DQGFDQKDOWWUDQVPLVVLRQDIWHU UHDGLQJWKHGDWDRXWRIWKH),)2DQGVHQGLQJLWIRUWKH&5&FDOFXODWLRQ,IDSDULW\HUURURFFXUVWKH),)2FRQWUROOHU VHWVDQHUURUVWDWXVELWJHQHUDWLQJDQLQWHUUXSWLILWLVHQDEOHG 3UHDPEOHDQG-DP*HQHUDWRU $VVRRQDVWKHWUDQVPLWHQDEOHELWLQWKHFRQWUROUHJLVWHULVVHWDQGWKHUHDUHHLJKWE\WHVRIGDWDLQWKH),)2WKH WUDQVPLWVWDWHPDFKLQHVWDUWVWKHWUDQVPLVVLRQE\DVVHUWLQJWKH7[BHQVLJQDODQGWUDQVPLWWLQJWKHSUHDPEOHDQGWKH VWDUWIUDPHGHOLPLWHU6)',QFDVHWKHUHLVDFROOLVLRQLWWUDQVPLWVDELWVWULQJRIVDIWHUWKHSUHDPEOHDVDMDP SDWWHUQ 3$'*HQHUDWRU ,IDVKRUWGDWDSDFNHWLVWUDQVPLWWHGWKH0$&ZLOOQRUPDOO\JHQHUDWHSDGE\WHVWRH[WHQGWKHSDFNHWWRDPLQLPXP RIE\WHV7KHSDGE\WHVFRQVLVWHQWLUHO\RIELWV$FRQWUROELWLVDOVRXVHGWRVXSSUHVVWKHJHQHUDWLRQRISDG E\WHV 3DUDOOHO&5&*HQHUDWRU 7KH&5&JHQHUDWLRQRIWKHRXWJRLQJGDWDVWDUWVIURPWKHGHVWLQDWLRQDGGUHVVDQGFRQWLQXHVWKURXJKWKHGDWDILHOG <RXFDQVXSSUHVV&5&JHQHUDWLRQE\VHWWLQJWKHDSSURSULDWHELWLQWKHWUDQVPLWFRQWUROUHJLVWHU7KLVLVXVHIXOLQ WHVWLQJIRUH[DPSOHWRIRUFHWKHWUDQVPLVVLRQRIDEDG&5&LQRUGHUWRWHVWHUURUGHWHFWLRQLQWKHUHFHLYHU,WFDQ DOVREHXVHIXOLQFHUWDLQEULGJHRUVZLWFKDSSOLFDWLRQVZKHUHHQGWRHQG&5&FKHFNLQJLVGHVLUHG (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7KUHVKROG/RJLFDQG&RXQWHUV 7KHWUDQVPLWVWDWHPDFKLQHXVHVDFRXQWHUDQGORJLFWRFRQWUROWKHWKUHVKROGRIZKHQWUDQVPLVVLRQFDQEHJLQ %HIRUHLWDWWHPSWVWRLQLWLDWHWUDQVPLVVLRQWKH0$&ZDLWVXQWLOHLJKWE\WHVRUDFRPSOHWHSDFNHWKDVEHHQSODFHGLQ WKHWUDQVPLW),)27KLVJLYHVWKH'0$HQJLQHVRPHODWHQF\ZLWKRXWFDXVLQJDQXQGHUIORZGXULQJWUDQVPLVVLRQ %DFN2IIDQG5HWUDQVPLW7LPHUV :KHQDFROOLVLRQLVGHWHFWHGRQWKHQHWZRUNWKHWUDQVPLWWHUEORFNVWRSVWKHWUDQVPLVVLRQDQGVWDUWVDMDPPLQJ SDWWHUQWRHQVXUHWKDWDOOWKHQRGHVGHWHFWWKHFROOLVLRQ$IWHUWKLVWKHWUDQVPLWWHUZDLWVIRUDPLQLPXPRIELWWLPHV DQGWKHQUHWUDQVPLWVWKHGDWD$IWHUDWWHPSWVWKHWUDQVPLWVWDWHPDFKLQHVHWVDQHUURUELWDQGJHQHUDWHVDQ LQWHUUXSWLIHQDEOHGWRVLJQLI\WKHIDLOXUHWRWUDQVPLWDSDFNHWGXHWRH[FHVVLYHFROOLVLRQV,WIOXVKHVWKH),)2DQG WKH0$&LVUHDG\IRUWKHQH[WSDFNHW 7UDQVPLW'DWD3DULW\&KHFNHU 'DWDLQWKH),)2LVRGGSDULW\SURWHFWHG:KHQGDWDLVUHDGIRUWUDQVPLVVLRQWKHWUDQVPLWVWDWHPDFKLQHFKHFNVWKH SDULW\,IDSDULW\HUURULVGHWHFWHGWKHWUDQVPLWGDWDSDULW\FKHFNHUGRHVWKHIROORZLQJ ,WVWRSVWUDQVPLVVLRQ ,WVHWVWKHSDULW\HUURUELWLQWKHWUDQVPLWVWDWXVUHJLVWHU ,WJHQHUDWHVDQLQWHUUXSWLIHQDEOHG 7UDQVPLW6WDWH0DFKLQH 7KHWUDQVPLWVWDWHPDFKLQHLVWKHFHQWUDOFRQWUROORJLFIRUWKHWUDQVPLWEORFN,WFRQWUROVWKHSDVVLQJRIVLJQDOVWKH WLPHUVDQGWKHSRVWLQJRIHUURUVLQWKHVWDWXVUHJLVWHUV .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 7+(0$&5(&(,9(%/2&. 7KH0$&UHFHLYHEORFNLVUHVSRQVLEOHIRUUHFHLYLQJGDWD,WFRPSOLHVZLWKWKH,(((6WDQGDUGIRU&DUULHU6HQVH 0XOWLSOH$FFHVVZLWK&ROOLVLRQ'HWHFWLRQ&60$&'SURWRFRO $IWHULWUHFHLYHVDSDFNHWWKHUHFHLYHEORFNFKHFNVIRUDQXPEHURIHUURUFRQGLWLRQV&5&HUURUVDOLJQPHQWHUURUV DQGOHQJWKHUURUV6HYHUDORIWKHVHFKHFNVFDQEHGLVDEOHGE\VHWWLQJELWVLQWKHDSSURSULDWHFRQWUROUHJLVWHUV 'HSHQGLQJRQWKH&$0VWDWXVWKHGHVWLQDWLRQDGGUHVVDQGWKHUHFHLYHEORFNPD\UHMHFWDQRWKHUZLVHDFFHSWDEOH SDFNHW7KH0$&UHFHLYHEORFNFRQVLVWVRIWKHIROORZLQJXQLWV 5HFHLYH),)2),)2FRQWUROOHUDQGFRXQWHUV 5HFHLYH%',VWDWHPDFKLQH 7KUHVKROGORJLFDQGFRXQWHUV &$0EORFNIRUDGGUHVVUHFRJQLWLRQ 3DUDOOHO&5&FKHFNHU 5HFHLYHVWDWHPDFKLQH 7KHPDLQFRPSRQHQWVRIWKHUHFHLYHEORFNDUHVKRZQLQ)LJXUH 5[B'%>@ $1'3$5,7< &$0 &+(&.(5 &5& &+(&.(5 % ' , 5[BUG 5[BUG\ 5[B(2) 5[BNHHS 5[BWRVV &$0BORDG &$0BKLW 5(&(,9( %', 67$7( 0$&+,1( 5($' $''5(66 0$& 5(&(,9( ),)2 [ 5['>@ 3$5,7< &+(&. :5,7($''5(66 :( 6)' '(7(&7 5[BFON 0 , , $ 1 ' :5,7(),)2 &21752//(5 $1'&2817(5 :5,7(),)2 &21752//(5 $1'&2817(5 5(&(,9( 67$7( 0$&+,1( 5[B'9 5[BHU 0 % < 7 ( ,) 7+5(6+2/' /2*,&$1' &2817(56 6\VBFON'20$,1 5[BFON'20$,1 )LJXUH0$&5HFHLYH)XQFWLRQ%ORFNV (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 5HFHLYH),)2&RQWUROOHU 7KHUHFHLYH),)2FRQWUROOHUDFFHSWVGDWDRQHE\WHDWDWLPH3DULW\VWDUWVZLWKWKHGHVWLQDWLRQDGGUHVV7KHUHFHLYH FRQWUROOHUXSGDWHVWKHFRXQWHUZLWKWKHQXPEHURIE\WHVUHFHLYHG$VWKH),)2VWRUHVWKHGDWDWKH&$0EORFN FKHFNVWKHGHVWLQDWLRQDGGUHVVDJDLQVWLWVVWRUHGDGGUHVV,IWKH&$0UHFRJQL]HVWKHDGGUHVVWKH),)2FRQWLQXHV UHFHLYLQJWKHSDFNHW,IWKH&$0EORFNGRHVQRWUHFRJQL]HWKHDGGUHVVDQGUHMHFWVWKHSDFNHWWKHUHFHLYHEORFN GLVFDUGVWKHSDFNHWDQGIOXVKHVWKH),)2 $GGUHVV&$0DQG$GGUHVV5HFRJQLWLRQ 7KH&$0EORFNSURYLGHVGLUHFWFRPSDULVRQDGGUHVVUHFRJQLWLRQ7KH&$0FRPSDUHVWKHGHVWLQDWLRQDGGUHVVRIWKH UHFHLYHGSDFNHWWRVWRUHGDGGUHVVHV,ILWILQGVDPDWFKWKHUHFHLYHVWDWHPDFKLQHFRQWLQXHVWRUHFHLYHWKHSDFNHW 7KH&$0LVRUJDQL]HGWRKROGVL[E\WHDGGUHVVHQWULHV:LWKLWVZRUGVL]HWKH&$0FDQVWRUHDGGUHVV HQWULHV &$0DGGUHVVHQWULHVDQGDUHXVHGWRVHQGWKH3DXVHFRQWUROSDFNHW7RVHQGD3DXVHFRQWUROSDFNHW\RX PXVWZULWHWKHGHVWLQDWLRQDGGUHVVWR&$0WKHVRXUFHDGGUHVVWR&$0DQGOHQJWKW\SHRSFRGHDQGRSHUDQG WRWKH&$0HQWU\<RXPXVWWKHPZULWHWKH0$&WUDQVPLWFRQWUROUHJLVWHUWRVHWWKH6HQG3DXVHFRQWUROELW,Q DGGLWLRQ&$0DQG&$0FDQEHXVHGWRFRQWUXFWDXVHUGHILQHFRQWUROIUDPH 3DUDOOHO&5&&KHFNHU 7KHUHFHLYHEORFNFRPSXWHVD&5&DFURVVWKHGDWDDQGWKHWUDQVPLWWHG&5&DQGWKHQFKHFNVWKDWWKHUHVXOWLQJ V\QGURPHLVYDOLG$SDUDOOHO&5&FKHFNLQJVFKHPHKDQGOHVGDWDDUULYLQJLQELWQLEEOHVDW0ELWVV7RVXSSRUW IXOOGXSOH[RSHUDWLRQWKHUHFHLYHDQGWUDQVPLWEORFNVKDYHLQGHSHQGHQW&5&FLUFXLWV 5HFHLYH6WDWH0DFKLQH ,Q0,,PRGHWKHUHFHLYHEORFNUHFHLYHVGDWDIURPWKH0,,RQWKH5['>@OLQHV7KLVGDWDLVV\QFKURQL]HGWR5[BFON DW0+]RU0+],Q0ELWVPRGHDQGDW0+]GDWDLVUHFHLYHGRQWKH5['BOLQHRQO\ $IWHULWGHWHFWVWKHSUHDPEOHDQG6)'WKHUHFHLYHVWDWHPDFKLQHDUUDQJHVGDWDLQE\WHFRQILJXUDWLRQVJHQHUDWHV SDULW\DQGVWRUHVWKHUHVXOWLQWKHUHFHLYH),)2RQHE\WHDWDWLPH,IWKH&$0EORFNDFFHSWVWKHGHVWLQDWLRQ DGGUHVVWKHUHFHLYH),)2VWRUHVWKHUHVWRIWKHSDFNHW$WWKHHQGRIWKHUHFHSWLRQWKHUHFHLYHEORFNPDUNVWKH SDFNHWUHFHLYHGE\VHWWLQJWKHDSSURSULDWHELWVLQWKHUHFHLYHVWDWXVUHJLVWHU$Q\HUURULQUHFHSWLRQZLOOUHVHWWKH ),)2DQGWKHVWDWHPDFKLQHZLOOZDLWIRUWKHHQGRIWKHFXUUHQWSDFNHW,WZLOOWKHQLGOHZKLOHLWLVZDLWLQJIRUWKHQH[W SUHDPEOHDQG6)' %'0$,QWHUIDFH5HFHLYH6WDWH0DFKLQH 7KH%'0$,)UHFHLYHVWDWHPDFKLQHLVVXHVWKH5[BUG\VLJQDOWRUHTXHVWWKDWWKH5HFHLYH),)2KDYHGDWD ZKHQHYHUGDWDLVSUHVHQWLQWKH5HFHLYH),)27KHODVWE\WHRIWKHSDFNHWLVVLJQDOHGE\DVVHUWLQJWKH5[B(2),Q FDVHWKHUHDUHDQ\HUURUVGXULQJWKHUHFHSWLRQRULIWKHUHLVD&5&HUURUDWWKHHQGWKH%'0$,)UHFHLYHVWDWH PDFKLQHDVVHUWVWKH5[BWRVVVLJQDOWRLQGLFDWHWKDWWKHUHFHLYHGSDFNHWVKRXOGEHGLVFDUGHG .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 )/2:&21752/%/2&. 7KHIORZFRQWUROEORFNSURYLGHVIRUWKHIROORZLQJIXQFWLRQV 5HFRJQLWLRQRI0$&FRQWUROIUDPHVUHFHLYHGE\WKHUHFHLYHEORFN 7UDQVPLVVLRQRI0$&FRQWUROIUDPHVHYHQLIWUDQVPLWWHULVSDXVHG 7LPHUVDQGFRXQWHUVIRU3DXVHRSHUDWLRQ &RPPDQGDQG6WDWXV5HJLVWHU&65LQWHUIDFH 2SWLRQVIRUSDVVLQJ0$&&RQWUROIUDPHVWKURXJKWRVRIWZDUHGULYHUV 7KHUHFHLYHORJLFLQWKHIORZFRQWUROEORFNUHFRJQL]HVD0$&FRQWUROIUDPHDVIROORZV 7KHOHQJWKW\SHILHOGPXVWKDYHWKHVSHFLDOYDOXHVSHFLILHGIRU0$&FRQWUROIUDPHV7KHGHVWLQDWLRQDGGUHVV PXVWEHUHFRJQL]HGE\WKH&$07KHIUDPHOHQJWKPXVWEHE\WHVLQFOXGLQJ&5&7KH&5&PXVWEHYDOLG DQGWKHIUDPHPXVWFRQWDLQDYDOLG3DXVHRSFRGHDQGRSHUDWLRQ ,IWKHOHQJWKW\SHILHOGGRHVQRWKDYHWKHVSHFLDOYDOXHVSHFLILHGIRU0$&FRQWUROIUDPHVWKH0$&WDNHVQR DFWLRQDQGWKHSDFNHWLVWUHDWHGDVDQRUPDOSDFNHW,IWKH&$0GRHVQRWUHFRJQL]HWKHGHVWLQDWLRQDGGUHVV WKH0$&UHMHFWVWKHSDFNHW,IWKHSDFNHWOHQJWKLVQRWE\WHVLQFOXGLQJ&5&WKH0$&GRHVQRWSHUIRUPWKH RSHUDWLRQ7KHSDFNHWLVWKHQPDUNHGDVD0$&FRQWUROSDFNHWDQGLVSDVVHGIRUZDUGWRWKHVRIWZDUHGULYHUV LISDVVWKURXJKLVHQDEOHG <RXFDQVHWFRQWUROELWVLQWKHWUDQVPLWVWDWXVUHJLVWHUWRJHQHUDWHD)XOO'XSOH[3DXVH2SHUDWLRQRURWKHU0$& FRQWUROIXQFWLRQVHYHQLIWKHWUDQVPLWWHULWVHOILVSDXVHG7ZRWLPHUVDQGWZRFRUUHVSRQGLQJ&65UHJLVWHUVDUHXVHG GXULQJD3DXVHRSHUDWLRQ2QHWLPHUUHJLVWHUSDLULVXVHGZKHQDUHFHLYHGSDFNHWFDXVHVWKHWUDQVPLWWHUWRSDXVH 7KHRWKHUSDLULVXVHGWRDSSUR[LPDWHWKHSDXVHVWDWXVRIWKHRWKHUHQGRIWKHOLQNDIWHUWKHWUDQVPLWWHUVHQGVD 3DXVHFRPDQG 7KH&RPPDQGDQG6WDWXV5HJLVWHU&65LQWHUIDFHSURYLGHVFRQWURODQGVWDWXVELWVZLWKLQWKHWUDQVPLWDQGUHFHLYH FRQWUROUHJLVWHUVDQGVWDWXVUHJLVWHUV7KHVHOHWV\RXLQLWLDWHWKHVHQGLQJRID0$&FRQWUROIUDPHHQDEOHDQG GLVDEOH0$&FRQWUROIXQFWLRQVDQGUHDGWKHYDOXHVRIWKHIORZFRQWUROFRXQWHUV &RQWUROELWVDUHSURYLGHGIRUSURFHVVLQJ0$&FRQWUROIUDPHVHQWLUHO\ZLWKLQWKHFRQWUROOHURUIRUSDVVLQJ0$& FRQWUROIUDPHVRQWRWKHVRIWZDUHGULYHUV7KLVOHWV\RXHQDEOHIORZFRQWUROE\GHIDXOWHYHQRQVRIWZDUHGULYHUV ZKLFKDUHQRWRWKHUZLVHIORZFRQWURODZDUH (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 %8))(5(''0$,17(5)$&( %8))(5(''0$%'0$&21752/%/2&.6 7KH%'0$HQJLQHFRQWUROVDWUDQVPLWEXIIHUDQGDUHFHLYHEXIIHU7KH%'0$WUDQVPLWEXIIHUKROGVGDWDDQGVWDWXV LQIRUPDWLRQIRUSDFNHWVEHLQJWUDQVPLWWHG7KH%'0$UHFHLYHEXIIHUKROGVGDWDDQGVWDWXVLQIRUPDWLRQIRUSDFNHWV EHLQJUHFHLYHG(DFK),)2KDVDFRQWUROEORFNZKLFKFRQWUROVGDWDEHLQJSODFHGLQDQGUHPRYHGIURPWKHEXIIHUV +DOIBIXOO +DOIBHPSW\ 6'>@ Q5(4B7[ %86 $5%,7(5 7[%86 5(48(67 7$,/3WU 7[B81'(5)/2: Q5(4 Q5(4B5[ $''5(66 *(1(5$725 5[%86 5(48(67 7$5*(7 $''5(66 )255; 7[:,'*(7 %,*/,77/( :25'72%<7( &219(57(5 '$7$6:$33(5 +($'3WU %'0$ 5[ %8))(5 [ 7[BFON +($'3WU %'0$ 7[ %8))(5 [ 7[BZU 7[ &21752/ 0$&+,1( 7[BUG\ +DOIBIXOO 7[B'%>@ % ' , % ' 0 $ ,) 6'>@ 6 < 6 7 ( 0 % 8 6 ,) Q$&. 6$>@ %,*/,77/( 5[BFON 5[BUG 7$,/3WU 6285&( $''5(66 5[B29(5)/2: )257; %<7(72:25' 5[B:,'*(7 &219(57(5 5[ &21752/ 0$&+,1( 5[BUG\ +DOIBHPSW\ 5[B'%>@ )LJXUH%'0$&RQWURO%ORFNV .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 7KH%XV$UELWHU 7KHEXVDUELWHUGHFLGHVZKLFKRIWKH%'0$EXIIHUFRQWUROOHUVWUDQVPLW7[RUUHFHLYH5[KDVWKHKLJKHVWSULRULW\ IRUDFFHVVLQJWKHV\VWHPEXV7KHSULRULWL]DWLRQLVG\QDPLF7KH%'0$DUELWHURXWSXWVDEXVUHTXHVWVLJQDOQ5(4 WRWKHV\VWHPPDQDJHUZKHQ $EXIIHUFRQWDLQVPRUHZRUGVWKDQWKH5[EXUVWVL]H $Q(2)(QGRI)UDPHZDVVDYHGWRWKHEXIIHURU $EXIIHUFRQWDLQVPRUHIUHHVSDFHWKDQWKH7[EXUVWVL]H $IWHULWUHFHLYHVDEXVDFNQRZOHJHVLJQDOQ$&.IURPWKHV\VWHPPDQDJHUWKH%'0$EXVDUELWRUGHWHUPLQHVWKH FRUUHFWEXVDFFHVVSULRULW\,IQ5(4B7[DQGQ5(4B5[ZHUHUHTXHVWHGVLPXOWDQHRXVO\WKHEXVDUELWRUGHFRGHVWKH Q$&.VLJQDOXVLQJWKHIROORZLQJPHWKRG VZLWFK+DOIBHPSW\+DOIBIXOO ^ FDVHEQ$&.B5[mQ$&. FDVHEQ$&.B7[mQ$&. GHIDXOWFDVHERUE LI5[EXIIVL]H+HDG7DLO7[EXIIVL]H5[PRUHXUJHQW Q$&.B5[mQ$&. HOVHQ$&.B7[mQ$&. ` (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 %'0$%XV&RQWURO/RJLF 7KHIXQFWLRQEORFNVRIWKH%'0$FRQWUROOHUSURYLGHORJLFIRUFRQWUROOLQJEXVPDVWHUUHDGDQGZULWHRSHUDWLRQV DFURVVWKHV\VWHPEXV7KLVFRQWUROORJLFVXSSRUWVWKHIROORZLQJRSHUDWLRQV %XUVWVL]HFRQWUROWRRSWLPL]HV\VWHPEXVXWLOL]DWLRQ 7UDQVPLWWKUHVKROGFRQWUROEDVHGRQRIWUDQVPLWEXIIHUVL]HWRPDWFKWUDQVPLVVLRQODWHQF\WRV\VWHPEXV ODWHQF\ /LWWOH(QGLDQE\WHVZDSSLQJWRVXSSRUWWKHGDWDWUDQVIHURI/LWWOH(QGLDQPHPRU\XVDJHIRUIUDPHGDWD $WUDQVPLWUHFHLYHDOLJQPHQWZLGJHWWRFLUFXPYHQWZRUGDOLJQPHQWUHVWULFWLRQV ,QV\VWHPVZLWKDQ$70/$1HPXODWLRQRUDQ032$LQWHUIDFHDQGLQFHUWDLQRWKHUV\VWHPVDVZHOOWKHEHJLQQLQJ RIDSDFNHWVKRXOGEHSODFHGRQDE\WHRUKDOIZRUGERXQGDU\<RXPD\QRWKRZHYHUPLVDOLJQWKH%'0$WUDQVIHU DVWKLVZRXOGFRPSOLFDWHWKHGHVLJQRIWKH'0$DQGZRXOGGHJUDGHSHUIRUPDQFH7RDYRLGWKLV\RXFDQXVHDQ DOLJQPHQWZLGJHWEHWZHHQWKH%'0$EXIIHUZRUGDQGWKH0$&),)2E\WH ,QWKHUHFHLYHUWKH%'0$EXVFRQWUROORJLFLQVHUWVDSURJUDPPDEOHQXPEHURIE\WHVXSWRWKUHHLQWRWKHUHFHLYHG GDWDVWUHDPZKLOHWKHSUHDPEOHLVEHLQJUHFHLYHG7KLVDGGVVRPHSDGGLQJWRWKHEHJLQQLQJRIWKHIUDPH7KLV SDGGLQJFDQWKHQEHXVHGWRVROYHDOLJQPHQWSUREOHPVGRZQVWUHDPZLWKRXWKDYLQJWRXVHDFRS\RIWKHEXIIHU %HFDXVHWKHUHLVQHYHUPRUHWKDQWKUHHE\WHVWKLVIHDWXUHGRHVQRWGHJUDGHSHUIRUPDQFH$OVREHFDXVHWKHGDWD LVLQVHUWHGSULRUWRWKHFRQFDWHQDWLRQRIE\WHVLQWRZRUGVLWGRHVQRWPLVDOLJQWKHVXEVHTXHQW'0$WUDQVIHU 7KHOHQJWKRIWKHDOLJQPHQWGDWDLVUHDGIURPDFRQWUROUHJLVWHU7KLVOHQJWKYDOXHVKRXOGEHVHWE\VRIWZDUH LPPHGLDWHO\DIWHUWKH0$&PRGXOHLVUHVHWDQGLWVKRXOGQRWEHPRGLILHG <RXFDQXVHDFRUUHVSRQGLQJWUDQVPLWDOLJQPHQWZLGJHWWRUHPRYHGDWDIURPWKHEXIIHU,QWKHVLPSOHVW LPSOHPHQWDWLRQWKHZLGJHWGLVFDUGVWKHILUVWQE\WHVXSWRWKUHHZKHUHQLVWKHYDOXHUHDGIURPWKHWUDQVPLW IUDPHGHVFULSWRUZKLFKFRQILJXUHVWKHWUDQVPLWDOLJQPHQWZLGJHW .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 0(025<'$7$6758&785(6 7KHIORZFRQWURO0ELWVHWKHUQHWFRQWUROOHUXVHVWKUHHGDWDVWUXFWXUHVWRH[FKDQJHFRQWUROLQIRUPDWLRQDQG GDWD 7UDQVPLWIUDPHGHVFULSWRU 5HFHLYHIUDPHGHVFULSWRU )UDPHGDWDEXIIHU (DFKIUDPHGHVFULSWRUKDVWKHIROORZLQJHOHPHQWV )UDPHVWDUWDGGUHVV 2ZQHUVKLSELW &RQWUROILHOGIRUWUDQVPLWWHU 6WDWXVILHOG )UDPHOHQJWK 1H[WIUDPHGHVFULSWRUSRLQWHU )LJXUHVKRZVGDWDVWUXFWXUHVRIWKHWUDQVPLWDQGUHFHLYHIUDPHGHVFULSWRUV (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 '$7$)5$0(6 7KHRZQHUVKLSELWLQWKH06%RIWKHIUDPHVWDUWDGGUHVVFRQWUROVWKHRZQHURIWKHGHVFULSWRU:KHQWKHRZQHUVKLS ELWLVWKH%'0$FRQWUROOHURZQVWKHGHVFULSWRU:KHQWKLVELWLVWKH&38RZQVWKHGHVFULSWRU7KHRZQHURI WKHGHVFULSWRUDOZD\VRZQVWKHDVVRFLDWHGGDWDIUDPH7KHGHVFULSWRUVIUDPHVWDUWDGGUHVVILHOGDOZD\VSRLQWVWR WKLVIUDPH $VLWUHFHLYHVWKHGDWDIUDPHVRIWZDUHVHWVWKHPD[LPXPIUDPHVL]HUHJLVWHULQWKH%'0$EORFNWRWKHV\VWHP IUDPHEXIIHUVL]HW\SLFDOO\WRRU6RIWZDUHDOVRVHWVWKH5[IUDPHGHVFULSWRUVWDUWDGGUHVVUHJLVWHUWR SRLQWWRDFKDLQRIIUDPHGHVFULSWRUVDOORIZKLFKKDYHWKHLURZQHUVKLSELWVHW 7KH%'0$HQJLQHFDQWKHQEHVWDUWHGWRVHWWKH%'0$UHFHLYHHQDEOHELWLQWKH%'0$5;&21UHJLVWHU:KHQD IUDPHLVUHFHLYHGLWLVFRSLHGLQWRPHPRU\DWWKHDGGUHVVVSHFLILHGE\WKH5[IUDPHVWDUWDGGUHVV3OHDVHQRWHWKDW QRFRQILJXUDEOHRIIVHWRUSDJHERXQGDU\FDOFXODWLRQLVUHTXLUHG7KHUHFHLYHGIUDPHLVZULWWHQLQWRWKHIUDPHGDWD EXIIHUXQWLOWKHHQGRIIUDPHLVUHDFKHGRUXQWLOWKHOHQJWKH[FHHGVWKHFRQILJXUHGPD[LPXPIUDPHVL]H ,IWKHHQWLUHIUDPHLVUHFHLYHGVXFFHVVIXOO\WKHVWDWXVELWVLQWKHIUDPHGHVFULSWRUDUHVHWWRLQGLFDWHWKLV2WKHUZLVH WKHVWDWXVELWVDUHVHWWRLQGLFDWHWKDWDQHUURURFFXUUHG7KHRZQHUVKLSELWLQWKHIUDPHVWDUWDGGUHVVILHOGLVFOHDUHG DQGDQLQWHUUXSWPD\QRZEHJHQHUDWHG7KH%'0$FRQWUROOHUFRSLHVWKHQH[WIUDPHGHVFULSWRUUHJLVWHUYDOXHLQWR WKH5[IUDPHGHVFULSWRUVWDUWDGGUHVVUHJLVWHU,IWKHQH[WIUDPHGHVFULSWRUDGGUHVVLVQXOOWKH%'0$VLPSO\ KDOWVDQGDOOVXEVHTXHQWIUDPHVDUHGURSSHG2WKHUZLVHWKHGHVFULSWRULVUHDGLQDQGWKH%'0$FRQWUROOHUVWDUWV DJDLQZLWKWKHQH[WIUDPHDVGHVFULEHGLQWKHSUHYLRXVSDUDJUDSK ,IWKHUHFHLYHGIUDPHVL]HH[FHHGVWKHPD[LPXPIUDPHVL]HWKHGDWDIUDPHZLOOEHRYHUZULWWHQE\WKHODVWZRUGRI PD[LPXPIUDPH7KHRYHUIORZGDWDLVZULWWHQWRWKH5[VWDWXVELW>@LQWKHUHFHLYHIUDPHGHVFULSWRU:KHQWKH %'0$UHDGVDGHVFULSWRULIWKHRZQHUVKLSELWLVQRWVHWLWKDVWZRRSWLRQV 6NLSWRWKHQH[WIUDPHGHVFULSWRURU *HQHUDWHDQLQWHUUXSWDQGKDOWWKH%'0$RSHUDWLRQ 7UDQVPLWIUDPHGHVFULSWRUVFRQWDLQWKHIROORZLQJFRPSRQHQWV $IRXUE\WHSRLQWHUWRWKHIUDPHGDWD :LGJHWDOLJQPHQWFRQWUROELWV>@ )UDPHGDWDSRLQWHULQFUHPHQWGHFUHPHQWELW>@ /LWWOH(QGLDQFRQWUROELW>@ ,QWHUUXSWHQDEOHDIWHUWUDQVPLW>@ 1R&5&>@DQG 1RSDGGLQJ>@ 'XULQJWUDQVPLVVLRQWKHWZRE\WHIUDPHOHQJWKDWWKH7[IUDPHGHVFULSWRULVPRYHGLQWRWKH%'0$LQWHUQDO7[ UHJLVWHU$IWHUWUDQVPLVVLRQ7[VWDWXVLVVDYHGLQWKH7[IUDPHGHVFULSWRU7KH%'0$FRQWUROOHUWKHQXSGDWHVWKH QH[WIUDPHGHVFULSWRUDGGUHVVUHJLVWHUIRUWKHOLQNHGOLVWVWUXFWXUH :KHQWKH7[IUDPHGHVFULSWRUVWDUWDGGUHVVUHJLVWHUSRLQWVWRWKHILUVWIUDPHEXIIHUWUDQVPLWWHUVWDUWVWUDQVPLWWLQJ WKHIUDPHGDWDLQWRWKHIUDPHEXIIHUPHPRU\ .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 2 )UDPH'DWD3RLQWHU 5HVHUYHG 5[6WDWXV 1H[W)UDPH'HVFULSWRU3RLQWHU )UDPH/HQJWK >@2ZQHUVKLSELW2 &38 %'0$ >@)UDPHGDWDSRLQWHU >@)UDPHOHQJWK >@5[VWDWXV $GGUHVVRIWKHIUDPHGDWDWREHVDYHG 7KHVL]HRIWKHUHFHLYHGIUDPH 7KH5[VWDWXVILHOGRIWKHUHFHLYHIUDPHLVXSGDWHG E\WKH0$&DIWHUUHFHSWLRQLVFRPSOHWH >@1H[WIUDPHGHVFULSWRUSRLQWHU $GGUHVVRIQH[WIUDPHGHVFULSWRU )LJXUH'DWD6WUXFWXUHRI5[)UDPH'HVFULSWRU (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 2 )UDPH'DWD3RLQWHU 5HVHUYHG 7[6WDWXV 1H[W)UDPH'HVFULSWRU3RLQWHU :$ $ / 7 & 3 )UDPH/HQJWK >@1RSDGGLQJPRGH3 3DGGLQJPRGH &5&PRGH 1RSDGGLQJPRGH 1R&5&PRGH >@1R&5&PRGH& >@0$&WUDQVPLWLQWHUUXSWHQDEOHDIWHUWUDQVPLVVLRQ RIWKLVIUDPH7 'LVDEOH (QDEOH >@/LWWOH(QGLDQPRGH/ %LJHQGLDQ /LWWOHHQGLDQ ,QFUHPHQW >@)UDPHGDWDSRLQWHULQFUHPHQWGHFUHPHQW$ 'HFUHPHQW >@:LGJHWDOLJQPHQWFRQWURO:$ 1RQDOLJQHGGDWDPXVWEHWUDQVPLWWHGZLWKRXWDOLJQPHQWFRQWURO 1RLQYDOLGE\WHV 2QHLQYDOLGE\WH 7ZRLQYDOLGE\WHV 7KUHHLQYDOLGE\WHV >@2ZQHUVKLSELW2 &38 %'0$ >@)UDPHGDWDSRLQWHU >@)UDPHOHQJWK >@7[VWDWXV 7KHDGGUHVVRIWKHIUDPHGDWDWREHWUDQVPLWWHG 7KHVL]HRIWKHWUDQVPLWIUDPH 7KLV7[IUDPHVWDWXVILHOGLVXSGDWHGE\WKH0$&DIWHUWUDQVPLVVLRQ >@1H[WIUDPHGHVFULSWRUSRLQWHU 7KHDGGUHVVRIWKHQH[WIUDPHGHVFULSWRU )LJXUH'DWD6WUXFWXUHRI7[)UDPH'HVFULSWRU .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 5[6WDWXV 5 [ + D O W H G * R R G / 2 5 R Y [ Q H 3 J U I D ( O U U R U Z & 5 & ( U U $ O L J Q ( U U 5 [ 6 W D W , Q W 5 [ & 2 W Y O 0 5 D F [ Y >@2YHUPD[LPXPVL]H2Y0D[ >@&RQWUROUHFHLYHG&WO5FY 6HWLIWKHUHFHLYHGIUDPHGDWDVL]HH[FHHGVWKHPD[LPXPIUDPHVL]H 6HWLIWKHUHFHLYHGSDFNHWLVD0$&FRQWUROIUDPH >@,QWHUUXSWRQUHFHLYH,QW5[ 6HWLIUHFHSWLRQRISDFNHWFDXVHGDQLQWHUUXSWFRQGLWLRQ7KLVLQFOXGHV*RRG UHFHLYHGLIWKH(QJRRGELW0$&5;&21>@LVVHW >@5HFHLYH0EVVWDWXV5[6WDW 6HWLISDFNHWZDVUHFHLYHGRYHUWKH0E\WHVLQWHUIDFH5HVHWLISDFNHWZDV UHFHLYHGRYHUWKH0,, >@$OLJQPHQWHUURU$OLJQ(UU >@&5&HUURU&5&(UU )UDPHOHQJWKLQELWVZDVQRWDPXOWLSOHRIHLJKWDQGWKH&5&ZDVLQYDOLG &5&DWHQGRISDFNHWGLGQRWPDWFKWKHFRPSXWHGYDOXHRUHOVHWKH3+< DVVHUWHG5[BHUGXULQJSDFNHWUHFHSWLRQ >@2YHUIORZHUURU2YHUIORZ >@/RQJHUURU/RQJ(UU 7KH0$&UHFHLYH),)2ZDVIXOOZKHQLWQHHGHGWRVWRUHDUHFHLYHGE\WH 5HFHLYHGDIUDPHORQJHUWKDQE\WHV1RWVHWLIWKH/RQJHQDEOHELW LQWKHUHFHLYHFRQWUROUHJLVWHULVVHW >@5HFHLYHSDULW\HUURU5[3DU >@*RRGUHFHLYHG*RRG 0$&UHFHLYH),)2KDVGHWHFWHGDSDULW\HUURU 6XFFHVVIXOO\UHFHLYHGDSDFNHWZLWKQRHUURUV,I(Q*RRG DQLQWHUUXSW LVJHQHUDWHGRQHDFKSDFNHWWKDWLVUHFHLYHGVXFFHVVIXOO\ >@5HFHSWLRQKDOWHG5[+DOWHG 5HFHSWLRQLQWHUUXSWHGE\XVHUFOHDULQJ5[(1RUVHWWLQJ+DOWOPPLQWKH0$& FRQWUROUHJLVWHU )LJXUH5['HVFULSWRU6WDWXV%LWV (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7[6WDWXV 7 [ + D O W H G & R P S 7 [ 3 D U / D W H & R O O 6 4 ( U U 1 & D U U ' H I H U 8 Q G H U , Q W 7 [ 3 D X V H G 7 [ ' H I H U ( [ & R O O 7[&ROO&QW >@7UDQVPLWFROOLVLRQFRXQW7[&ROO&QW &RXQWRIFROOLVLRQVGXULQJWUDQVPLVVLRQRIDVLQJOHSDFNHW$IWHUFROOLVLRQV 7[&ROOLV]HURDQG([&ROOLVVHW >@([FHVVLYHFROOLVLRQ([&ROO >@7UDQVPLWGHIHUUHG7['HIHU >@3DXVHG FROOLVLRQVRFFXUHGLQWKHVDPHSDFNHW >@,QWHUUXSWRQWUDQVPLW,QW7[ 6HWLIWUDQVPLVVLRQRISDFNHWFDXVHGDQLQWHUUXSWFRQGLWLRQ7KLVLQFOXGHVWKH HQDEOHFRPSOHWLRQ(Q&RPS0$&7;&21>@LIHQDEOHG >@8QGHUUXQ8QGHU >@'HIHUUDO'HIHU 0$&WUDQVPLW),)2EHFRPHVHPSW\ GXULQJWUDQVPLVVLRQ 0$&GHIHUVIRUPD[BGHIHUUDOPVIRU0ELWVVRUPVIRU 0ELWVV >@1RFDUULHU1&DUU &DUULHUVHQVHLVQRWGHWHFWHGGXULQJWKHHQWLUHWUDQVPLVVLRQRIDSDFNHW IURPWKH6)'WRWKH&5& >@64(HUURU64(UU $IWHUWUDQVPLWIUDPHVHWLIWKHIDNHFROOLVLRQ&2/VLJQDOGLGQRWFRPHIURP WKH3+<IRU V P >@/DWHFROOLVLRQ/DWH&ROO $FROOLVLRQRFFXUUHGDIWHUELWWLPHVE\WHWLPHV >@7UDQVPLWSDULW\HUURU7[3DU >@&RPSOHWLRQ&RPS 0$&WUDQVPLW),)2GHWHFWHGDSDULW\HUURU 0$&FRPSOHWHGDWUDQVPLWRUGLVFDUGRIRQHSDFNHW >@7UDQVPLVVLRQKDOWHG7[+DOWHG 7UDQVPLVVLRQKDOWHGE\FOHDULQJ7[(QRUVHWWLQJWKH+DOWOPPLQWKH0$&FRQWURO UHJLVWHU2UDQLQWHUUXSWZDVJHQHUDWHGE\DQHUURUFRQGLWLRQQRWFRPSOHWLRQ )LJXUH7['HVFULSWRU6WDWXV%LWV .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 )5$0( '(6&5,3725 67$57$''5(66 5(*,67(5 )5$0('$7$32,17(5 )5$0('$7$ 8QXVHG 5(&(,9()5$0( 0$;,0806,=( 5(*,67(5 %'0$5;/6= 67$786 )5$0(/(1*7+ 1(;7)5$0('(6&5,3725 )5$0('$7$32,17(5 )5$0('$7$ 8QXVHG %'0$5;/6= )255,1*7<3( /,1.('/,67 67$786 )5$0(/(1*7+ 1(;7)5$0('(6&5,3725 )5$0('$7$1 )5$0('$7$32,17(51 0HPRU\IRUIUDPHEXIIHU 67$786 )5$0(/(1*7+ ,QVLQJOH OLQNHGOLVWVWKHODVWQH[WIUDPH GHVFULSWRULVILOOHGZLWKD1XOODGGUHVV %'0$5;/6= 1(;7)5$0('(6&5,3725 )LJXUH'DWD6WUXFWXUHRIWKH5HFHLYH)UDPH'DWD%XIIHU (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(563(&,$/5(*,67(56 7KHVSHFLDOUHJLVWHUVXVHGE\WKH.6&HWKHUQHWFRQWUROOHUDUHGLYLGHGLQWRWZRPDLQJURXSV %'0$FRQWURODQGVWDWXVUHJLVWHUV 0$&FRQWURODQGVWDWXVUHJLVWHUV %'0$&21752/$1'67$7865(*,67(56 $OOUHJLVWHUVWKDWFRQWDLQDPHPRU\DGGUHVVPXVWVWRUHWKHDGGUHVVLQDZRUGDOLJQHGIRUPDW 7DEOH%'0$&RQWURODQG6WDWXV5HJLVWHUV 5HJLVWHUV %'0$7;&21 %'0$5;&21 %'0$7;375 %'0$5;375 %'0$5;/6= %'0$67$7 &$0 %'0$7;%8) VHH1RWHV VHH1RWHV 2IIVHW [ [ [ [& [ [ [ [& [ [)& [ [)& 5: 5: 5: 5: 5: 5: 5: : 5: 5: 'HVFULSWLRQ %XIIHUHG'0$WUDQVPLWFRQWUROUHJLVWHU %XIIHUHG'0$UHFHLYHFRQWUROUHJLVWHU 7UDQVPLWIUDPHGHVFULSWRUVWDUWDGGUHVV 5HFHLYHIUDPHGHVFULSWRUVWDUWDGGUHVV 5HFHLYHIUDPHPD[LPXPVL]H %XIIHUHG'0$VWDWXV &$0FRQWHQWZRUGV %'0$WUDQVPLW7[EXIIHUZRUGV IRUWHVWPRGHDGGUHVVLQJRQO\ %'0$UHFHLYH5[EXIIHUZRUGV IRUWHVWPRGHDGGUHVVLQJRQO\ 5HVHW9DOXH [ [ [)))))))) [)))))))) 8QGHILQHG [ 8QGHILQHG 8QGHILQHG 8QGHILQHG %'0$5;%8) 127(6 )RUWHVWLQJ\RXFDQUHDGWKH%'0$7[5[EXIIHUGLUHFWO\7KH%'0$UHFHLYHEXIIHUKDVDZRUGE\ELWVL]H7KH KLJKHVWELW>@LQGLFDWHVWKHGDWDIUDPHERXQGDU\DVVKRZQLQWKHIROORZLQJLOOXVWUDWLRQ [ [ [& [& (2)(QGRI)UDPH%RXQGDU\RIIUDPHGDWD <RXFDQDFFHVVWKH(2)ELWE\UHDGLQJWKHDGGUHVVUDQJH[[&UHDGLQWR/6%ELW .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 %XIIHUHG'0$5HFHLYH&RQWURO5HJLVWHU 7KHEXIIHUHG'0$UHFHLYHFRQWUROUHJLVWHU%'0$5;&21LVGHVFULEHGLQ7DEOHVDQGEHORZ 7DEOH%'0$5;&215HJLVWHU 5HJLVWHU %'0$5;&21 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ %XIIHUHG'0$UHFHLYHFRQWUROUHJLVWHU 5HVHW9DOXH [ 7DEOH%'0$5HFHLYH&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH %'0$5[EXUVWVL]H%5[%567 'HVFULSWLRQ :RUGVL]HRIGDWDEXUVWVUHTXHVWHGLQ%'0$PRGH,I WKH%5[%567LVWKHEXUVWVL]HLVRQHZRUG,IWKH %5[%567LVWKHEXUVWVL]HLVZRUGV >@ %'0$5[VWRSVNLSIUDPHE\RZQHU 7KLVELWGHWHUPLQHVZKHWKHUWKH%'0$5[FRQWUROOHULVVXHV ELW%5[676.2 DQLQWHUUXSWLIHQDEOHGRUVNLSVWKHFXUUHQWIUDPHDQGJRHV WRWKHQH[WIUDPHGHVFULSWRUDVVXPLQJ%'0$LVQRWWKH RZQHU %'0$5[PHPRU\DGGUHVVLQFGHF 7KLVELWGHWHUPLQHVZKHWKHUWKHDGGUHVVLVLQFUHPHQWHGRU %5[0$,1& GHFUHPHQWHG,IWKLVELWLVVHWWRWKHDGGUHVVZLOOEH LQFUHPHQWHG %'0$5[HYHU\UHFHLYHGIUDPH LQWHUUXSWHQDEOH%5[',( %'0$5[1XOOOLVWLQWHUUXSWHQDEOH %5[1/,( 7KLVELWHQDEOHVWKH%'0$5[HYHU\UHFHLYHGIUDPH LQWHUUXSWZKLFKLVJHQHUDWHGE\WKH%'0$FRQWUROOHUHDFK WLPHLVPRYHVDFRPSOHWHGDWDIUDPHLQWRPHPRU\ 7KLVELWHQDEOHVWKH%'0$5[1XOOOLVWLQWHUUXSWZKLFK LQGLFDWHVWKDWWKHUHFHLYHIUDPHGHVFULSWRUVWDUWDGGUHVV SRLQWHU%'0$5;375LQWKH%'0$5[EORFNKDVD1XOO [DGGUHVV 7KLVELWHQDEOHVWKH%'0$5[QRWRZQHULQWHUUXSWZKHQWKH RZQHUVKLSELWRIWKHFXUUHQWIUDPHGRHVQRWEHORQJWRWKH %'0$FRQWUROOHUDQGLIWKH%5[676.2ELWLVVHW 7KLVELWHQDEOHVWKH%'0$5[PD[LPXPVL]HRYHULQWHUUXSW ZKHQWKHUHFHLYHGIUDPHVL]HLVODUJHUWKDQWKHYDOXHLQ UHFHLYHIUDPHPD[LPXPVL]HUHJLVWHU 7KLVELWGHWHUPLQHVZKHWKHUWKHGDWDLVVWRUHGLQ/LWWOHRU %LJ(QGLDQIRUPDW,ILWLVVHWWRZRUGVZDSSLQJZLOOWDNH SODFHEHWZHHQWKHUHFHLYHEXIIHUDQGWKHV\VWHPGDWDEXV 7KH5[ZRUGDOLJQPHQWELWVGHWHUPLQHKRZPDQ\E\WHVDUH LQYDOLGLQWKHILUVWZRUGRIHDFKGDWDIUDPH7KHVHLQYDOLG E\WHVDUHLQVHUWHGZKHQWKHZRUGLVDVVHPEOHGE\WKH %'0$FRQWUROOHU 1RLQYDOLGE\WHV LQYDOLG E\WH LQYDOLGE\WHVDQG LQYDOLGE\WHV >@ >@ >@ >@ %'0$5[QRWRZQHULQWHUUXSW HQDEOH%5[12,( %'0$5[PD[LPXPVL]HRYHU LQWHUUXSWHQDEOH%5[062,( %'0$5[%LJ/LWWOH(QGLDQ %5[/LWWOH %'0$5[ZRUGDOLJQPHQW %5[:$ >@ >@ >@ (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7DEOH%'0$5HFHLYH&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH %'0$5[HQDEOH%5[(Q 'HVFULSWLRQ :KHQWKH5[HQDEOHELWLVVHWWRWKH%'0$5[EORFNLV HQDEOHG(YHQLIWKLVELWLVGLVDEOHGWKH0$&ZLOOUHFHLYH5[ GDWDXQWLOWKH0$&5[),)2RYHUIORZVDVORQJDVWKH),)2 LVQRWHPSW\DQGWKH0$&5[LVHQDEOHG7KLVELWLV DXWRPDWLFDOO\GLVDEOHGLQWKHIROORZLQJFDVHVLIWKHQH[W IUDPHSRLQWHULV1XOORULIWKHRZQHUELWLV]HURDQGWKH %5[676.2ELWLVVHW 127(7KHIUDPHGHVFULSWRUVWDUWDGGUHVVSRLQWHUPXVWEH DVVLJQHGEHIRUHWKH%'0$5[HQDEOHELWLVVHW 6HWWKLVELWWRWRUHVHWWKH%'0$5[EORFN 6HWWKLVELWLVWRHQDEOHWKH5[EXIIHUHPSW\LQWHUUXSW 6HWWKLVELWWRWRHQDEOHWKH5[HDUO\QRWLI\LQWHUUXSW7KH IXQFWLRQRIWKLVLQWHUUXSWLVWRQRWHWKHOHQJWKRIDGDWDIUDPH WKDWLVEHLQJUHFHLYHGIURPLWVIUDPHOHQJWKILHOG >@ >@ >@ %'0$5[UHVHW%5[56 %'0$5[EXIIHUHPSW\LQWHUUXSW HQDEOH%5[(PSW\ %'0$5[HDUO\QRWLI\LQWHUUXSW HQDEOH%5[(DUO\ .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 %'0$5;&215HJLVWHU 5(6(59(' % 5 [ ( D U O \ % 5 [ ( P S W \ % 5 [ 5 6 % 5 [ ( Q % 5 [ : $ % 5 [ / L W W O H % 5 [ 0 6 2 , ( % 5 [ 1 2 , ( % 5 [ 1 / , ( % 5 [ ' , ( % 5 [ 0 $ , 1 & % 5 [ 6 7 6 . 2 %5[%567 >@%'0$5[EXUVWVL]H%5[%567 %XUVWGDWDVL]H %5[%567ZRUG >@%'0$5[VWRSVNLSIUDPHRULQWHUUXSWLIQRWRZQHURIWKHFXUUHQWIUDPH %5[676.2 6NLSVWKHFXUUHQWIUDPHDQGJRHVWRWKHQH[WIUDPHGHVFULSWRU %'0$UHFHLYHUJHQHUDWHVDQLQWHUUXSWLIHQDEOHG 'HFUHPHQWWKHIUDPHPHPRU\DGGUHVV ,QFUHPHQWWKHIUDPHPHPRU\DGGUHVV 'LVDEOHIUDPHUHFHLYHGRQHLQWHUUXSW (QDEOHIUDPHUHFHLYHGRQHLQWHUUXSW >@%'0$5[PHPRU\DGGUHVVLQFUHPHQWGHFUHPHQW'5[0$,1& >@%'0$5[HYHU\UHFHLYHIUDPHLQWHUUXSWHQDEOH%5[',( >@%'0$5[1XOOOLVWLQWHUUXSWHQDEOH%5[1/,( 'LVDEOH1XOODGGUHVV[UHFHLYHLQWHUUXSW (QDEOH1XOODGGUHVV[UHFHLYHLQWHUUXSW >@%'0$5[QRWRZQHULQWHUUXSWHQDEOH %5[12,( 'LVDEOHLQWHUUXSWIRU%'0$5[QRWRZQHURIWKHFXUUHQWIUDPH (QDEOHLQWHUUXSWIRU%'0$5[QRWRZQHURIWKHFXUUHQWIUDPH >@%'0$5[PD[LPXPVL]HRYHULQWHUUXSWHQDEOH%5[062,( 'LVDEOHLQWHUUXSWIRUUHFHLYHGIUDPHLIODUJHUWKDQWKHPD[LPXPIUDPHVL]H (QDEOHLQWHUUXSWIRUUHFHLYHGIUDPHLIODUJHUWKDQWKHPD[LPXPIUDPHVL]H >@%'0$5[%LJ/LWWOH(QGLDQ%5[/LWWOH %LJ(QGLDQIUDPHGDWDIRUPDW /LWWOH(QGLDQ)UDPHGDWDLQ%'0$5[EXIIHULVZRUGVZDSSHGRQWKHV\VWHPEXV >@%'0$5[ZRUGDOLJQPHQW%5[:$ 'RQRWLQVHUWDQLQYDOLGE\WHLQWKHILUVWUHFHLYHGIUDPHGDWD ,QVHUWRQHLQYDOLGE\WHLQWKHILUVWUHFHLYHGIUDPHGDWD ,QVHUWWZRLQYDOLGE\WHVLQWKHILUVWUHFHLYHGIUDPHGDWD ,QVHUWWKUHHLQYDOLGE\WHVLQ WKHILUVWUHFHLYHGIUDPHGDWD >@%'0$5[HQDEOH%5[(Q 'LVDEOHWKH%'0$UHFHLYHU,IWKH0$&5[),)2LVQRWHPSW\PRYHGDWDWRWKH%'0$5[EXIIHU (QDEOHWKH%'0$UHFHLYHU >@%'0$5[UHVHW%5[56 1RHIIHFW 5HVHWWKH%'0$UHFHLYHU >@%'0$5[EXIIHUHPSW\LQWHUUXSW5[(PSW\ 'LVDEOHWKH5[EXIIHUHPSW\LQWHUUXSW (QDEOHWKH5[EXIIHUHPSW\LQWHUUXSW >@%'0$5[HDUO\QRWLI\LQWHUUXSW%5[(DUO\ 'LVDEOHWKH5[HDUO\QRWLI\LQWHUUXSW (QDEOHWKHLQWHUUXSWZKHQ%'0$FDSWXUHVWKHOHQJWKRIWKHUHFHLYHGIUDPHW\SH )LJXUH%XIIHUHG'0$5HFHLYHU&RQWURO5HJLVWHU (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 %XIIHUHG'0$7UDQVPLW&RQWURO5HJLVWHU 7KHEXIIHUHG'0$WUDQVPLWFRQWUROUHJLVWHU%'0$7;&21LVGHVFULEHGLQ7DEOHVDQGEHORZ 7DEOH%'0$7;&215HJLVWHU 5HJLVWHU %'0$7;&21 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ %XIIHUHG'0$WUDQVPLWFRQWUROUHJLVWHU 5HVHW9DOXH [ 7DEOH%'0$7UDQVPLW&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH %'0$7[EXUVWVL]H%7[%567 'HVFULSWLRQ :RUGVL]HRIGDWDEXUVWVUHTXHVWHGLQ%'0$PRGH,I WKH%7[%567LVWKHEXUVWVL]HLVRQHZRUG,IWKH %7[%567LVWKHEXUVWVL]HLVZRUGV >@ %'0$7[VWRSVNLSIUDPHE\RZQHU 7KLVELWGHWHUPLQHVZKHWKHUWKH%'0$7[FRQWUROOHULVVXHV ELW%7[676.2 DQLQWHUUXSWLIHQDEOHGRUVNLSVWKHFXUUHQWIUDPHDQGJRHV WRWKHQH[WIUDPHGHVFULSWRUDVVXPLQJ%'0$LVQRWWKH RZQHU 5HVHUYHG 1RWDSSOLFDEOH %'0$7[FRPSOHWHWRVHQGFRQWURO 6HWWLQJWKLVELWHQDEOHVWKH%'0$7[FRPSOHWHWRVHQG FRQWROSDFNHWLQWHUUXSWZKHQWKH0$&KDVILQLVKHGVHQGLQJ SDFNHWLQWHUUXSWHQDEOH %7[&&3,( WKHFRQWUROSDFNHW %'0$7[1XOOOLVWLQWHUUXSWHQDEOH %7[1/,( 7KLVELWHQDEOHVWKH%'0$7[1XOOOLVWLQWHUUXSWZKLFK LQGLFDWHVWKDWWKHUHFHLYHIUDPHGHVFULSWRUVWDUWDGGUHVV SRLQWHU%'0$7;375LQWKH%'0$7[EORFNKDVDQXOO [DGGUHVV 7KLVELWHQDEOHVWKH%'0$7[QRWRZQHULQWHUUXSWZKHQWKH RZQHUVKLSELWRIWKHFXUUHQWIUDPHGRHVQRWEHORQJWRWKH %'0$FRQWUROOHUDQGLIWKH%7[676.2ELWLVVHW 6HWWKLVELWLVWRHQDEOHWKH7[EXIIHUHPSW\LQWHUUXSW 7KHVHELWVGHWHUPLQHZKHQWKHQHZIUDPHGDWDLQ%'0$7[ EXIIHUFDQEHPRYHGWRWKH0$&7[),)2ZKHQDQHZ IUDPHDUULYHV PHDQVQRZDLWPHDQVZDLWWRILOORIWKH %'0$7[EXIIHUPHDQVZDLWWRILOORIWKHEXIIHU DQGVRRQWKURXJKZKLFKPHDQVZDLWWRILOORIWKH %'0$7[EXIIHU 127(,IWKHODVWGDWDRIWKHIUDPHDUULYHVLQ%'0$7[ EXIIHUWKHGDWDWUDQVIHUIURPWKH%'0$7[EXIIHUWRWKH 0$&7[),)2VWDUWVLPPHGLDWHO\UHJDUGOHVVRIWKHOHYHORI WKHVHELWV >@ >@ >@ >@ %'0$7[QRWRZQHULQWHUUXSW HQDEOH%7[12,( %'0$7[EXIIHUHPSW\LQWHUUXSW HQDEOH%7[(PSW\ %'0$WUDQVPLWWR0$&7[VWDUW OHYHO%7[06/ >@ >@ .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 7DEOH%'0$7UDQVPLW&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH %'0$7[HQDEOH%7[(Q 'HVFULSWLRQ :KHQWKH7[HQDEOHELWLVVHWWRWKH%'0$7[EORFNLV HQDEOHG(YHQLIWKLVELWLVGLVDEOHGEXIIHUGDWDZLOOEH PRYHGWRWKH0$&7[),)2XQWLOWKH%'0$7[EXIIHU XQGHUIORZVDVORQJDVWKH),)2LVQRWHPSW\DQGWKH0$& 7[LVHQDEOHG 7KLVELWLVDXWRPDWLFDOO\GLVDEOHGLQWKHIROORZLQJFDVHVLI WKHQH[WIUDPHSRLQWHULV1XOORULIWKHRZQHUELWLV]HUR DQGWKH%7[676.2ELWLVVHW 127(7KHIUDPHGHVFULSWRUVWDUWDGGUHVVSRLQWHUPXVWEH DVVLJQHGEHIRUHWKH%'0$7[HQDEOHELWLVVHW 6HWWKLVELWWRWRUHVHWWKH%'0$7[EORFN >@ %'0$7[UHVHW%7[56 (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 5(6(59(' % 7 [ 5 6 % 7 [ ( Q % 7 [ 0 6 / % 7 [ ( P S W \ % 7 [ 1 2 , ( % 7 [ 1 / , ( % 7 [ & & 3 , ( % 7 [ 6 7 6 . 2 %5[%567 >@%'0$7[EXUVWVL]H%7[%567 :RUGVL]HRIGDWDEXUVWVUHTXHVWHGLQ%'0$PRGH,I%7[%567LV]HURWKHEXUVWVL]HLV RQHZRUG,I%W;%567LVWKHEXUVWVL]HLVZRUGV >@%'0$7[VWRSVNLSIUDPHE\RZQHUELW 6NLSVWKHFXUUHQWIUDPHDQGJRHVWRWKHQH[WIUDPHGHVFULSWRU LI%'0$LVQRWWKHRZQHURIWKHIUDPH %'0$WUDQVPLWWHUJHQHUDWHVDQLQWHUUXSWLIHQDEOHG >@5HVHUYHG >@%'0$7[FRPSOHWHWRVHQGFRQWUROSDFNHWLQWHUUXSWHQDEOH%7[&&3,( 'LVDEOHFRPSOHWHWRVHQGFRQWUROSDFNHWLQWHUUXSW (QDEOHFRPSOHWHWRVHQGFRQWUROSDFNHWLQWHUUXSW7KHLQWHUUXSWLVJHQHUDWHGZKHQWKH0$& FRPSOHWHVVHQGLQJWKHFRQWUROSDFNHW >@%'0$7[1XOOOLVWLQWHUUXSWHQDEO H 'LVDEOHWUDQVPLW1XOOOLVWLQWHUUXSW (QDEOH1XOOOLVWLQWHUUXSWWRLQGLFDWHWKDW%'0$7[375LQWKH%'0$7[XQLWKDVD1XOODGGUHVV [ >@%'0$7[QRWRZQHULQWHUUXSWHQDEOH%7[12,( 'LVDEOH%'0$7[QRWRZQHULQWHUUXSWIRUWKHFXUUHQWIUDPH (QDEOH%'0$7[QRWRZQHULQWHUUXSWIRUWKHFXUUHQWIUDPHDQGLIWKH%7[676.2ELWLVVHW >@%'0$7[EXIIHUHPSW\LQWHUUXSW%7[(PSW\ 'LVDEOH7;EXIIHUHPSW\LQWHUUXSW (QDEOH7;EXIIHUHPSW\LQWHUUXSW 1RZDLWLQJ :DLWWRILOORIWKH7[EXIIHU :DLWWRILOORIWKH7[EXIIHU :DLWWRILOORIWKH7[EXIIHU >@%'0$WUDQVPLWWR0$&7[VWDUWOHYHO%7[06/ 127(8VHWKLVIRUPXODWRFDOFXODWHWUDQVPLWWLPHWRWKH0$&7[),)2 W%WR0 %7[06/6L]HRIWKH%'0$7[EXIIHU >@%'0$7[HQDEOH%7[(Q 'LVDEOHWKH%'0$WUDQVPLWWHU (QDEOHWKH%'0$WUDQVPLWWHU >@%'0$7[UHVHW%7[56 1RHIIHFW 5HVHWWKH%'0$7[EORFN )LJXUH%XIIHUHG'0$7UDQVPLW&RQWURO5HJLVWHU .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 %'0$7UDQVPLW)UDPH'HVFULSWRU6WDUW$GGUHVV5HJLVWHU 7DEOH%'0$7;3755HJLVWHU 5HJLVWHU %'0$7;375 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ 7UDQVPLWIUDPHGHVFULSWRUVWDUWDGGUHVV 5HVHW9DOXH [)))))))) 7DEOH%'0$7UDQVPLW)UDPH'HVFULSWRU6WDUW$GGUHVV5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH %'0$WUDQVPLWIUDPHGHVFULSWRU VWDUWDGGUHVV 'HVFULSWLRQ 7KH%'0$WUDQVPLWIUDPHGHVFULSWRUVWDUWDGGUHVVUHJLVWHU FRQWDLQVWKHDGGUHVVRIWKHIUDPHGHVFULSWRURQWKHIUDPH WREHVHQW'XULQJD%'0$RSHUDWLRQWKLVVWDUWDGGUHVV SRLQWHULVXSGDWHGWRWKHQH[WIUDPHDGGUHVV %'0$5HFHLYH)UDPH'HVFULSWRU6WDUW$GGUHVV5HJLVWHU 7DEOH%'0$5;3755HJLVWHU 5HJLVWHU %'0$5;375 2IIVHW$GGUHVV [& 5: 5: 'HVFULSWLRQ 5HFHLYHIUDPHGHVFULSWRUVWDUWDGGUHVV 5HVHW9DOXH [)))))))) 7DEOH%'0$5HFHLYH)UDPH'HVFULSWRU6WDUW$GGUHVV5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH %'0$UHFHLYHIUDPHGHVFULSWRU VWDUWDGGUHVV 'HVFULSWLRQ 7KH%'0$UHFHLYHIUDPHGHVFULSWRUVWDUWDGGUHVVUHJLVWHU FRQWDLQVWKHDGGUHVVRIWKHIUDPHGHVFULSWRURQWKHIUDPH WREHVDYHG'XULQJD%'0$RSHUDWLRQWKLVVWDUWDGGUHVV SRLQWHULVXSGDWHGWRWKHQH[WIUDPHDGGUHVV (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 %'0$5HFHLYH)UDPH0D[LPXP6L]H5HJLVWHU 7DEOH%'0$7;/6=5HJLVWHU 5HJLVWHU %'0$5;/6= 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ 5HFHLYHIUDPHPD[LPXPVL]H 5HVHW9DOXH 8QGHILQHG 7DEOH%'0$5HFHLYH)UDPH0D[LPXP6L]H5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH %'0$UHFHLYHIUDPHPD[LPXP VL]H%5[/6= %'0$UHFHLYHIUDPHOHQJWK %5[)6=UHDGRQO\ 'HVFULSWLRQ 7KLVUHJLVWHUYDOXHFRQWUROVKRZPDQ\E\WHVSHUIUDPHFDQ EHVDYHGWRPHPRU\,IWKHUHFHLYHGIUDPHVL]HH[FHHGVWKH YDOXHVWRUHGLQWKLVORFDWLRQDQHUURUFRQGLWLRQLVUHSRUWHG :KHQDQHDUO\QRWLILFDWLRQ(DUO\1RWLI\LQWHUUXSWRFFXUV WKHIUDPHOHQJWK(WKHUQHWW\SHILHOGFRQWDLQVWKH)UDPH VL]HRIWKHIUDPHWKDWLVFXUUHQWO\EHLQJUHFHLYHG 7RVDYHVSDFHLQWKHIUDPHPHPRU\EXIIHU\RXFDQ GHWHUPLQHWKHFXUUHQWIUDPHOHQJWKE\HQDEOLQJWKHHDUO\ QRWLILFDWLRQLQWHUUXSWDQGUHDGLQJWKH%5[)6=ILHOGZKHQ WKHLQWHUUXSWRFFXUV 7RFDOFXODWHWKHYDOXHRIWKHQH[WIUDPHVWDUWDGGUHVV SRLQWHU\RXDGGWKHFXUUHQWIUDPHVL]HYDOXH%5[)6=WR WKH%'0$UHFHLYHVWDUWDGGUHVVUHJLVWHU)RUDFRQWURO SDFNHWDGGLWLRQDOVSDFHPD\EHQHHGHG 127(7RREWDLQWKHQH[W5[IUDPHDGGUHVVWKDWLVWREH VDYHGLQWKH5[IUDPHVWDUWDGGUHVVUHJLVWHUZH UHFRPPHQGWKDW\RXILUVWKDOWWKH%'0$RSHUDWLRQ >@ %'0$6WDWXV5HJLVWHU 7DEOH%'0$67$75HJLVWHU 5HJLVWHU %'0$67$7 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ %XIIHUHG'0$VWDWXV 5HVHW9DOXH [ .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 7DEOH%'0$6WDWXV5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ %LW1DPH %'0$5[GRQHHYHU\UHFHLYHG IUDPH%5[5') %'0$5[QXOOOLVW%5[1/ 'HVFULSWLRQ 7KLVELWLVVHWHDFKWLPHWKH%'0$UHFHLYHUPRYHVRQH UHFHLYHGGDWDIUDPHWRPHPRU\ ,IWKLVELWLVVHWWKH%'0$5;375KDVDQXOODGGUHVV(YHQ LI%'0$5[LVGLVDEOHGGDWDLVWUDQVIHUUHGIURPWKH0$& 5[),)2WRWKH%'0$5[EXIIHUXQWLOWKH%'0$5[EXIIHU RYHUIORZV7KLVELWLVUHDGRQO\ ,IWKLVELWLVVHW%'0$LVQRWWKHRZQHURIWKHFXUUHQWGDWD IUDPH7KH%5[676.2ELWLVVHWDQG%'0$5[LVVWRSSHG ,IWKLVELWLVVHWWKHUHFHLYHGIUDPHVL]HLVODUJHUWKDQWKH YDOXHLQWKH5[IUDPHPD[LPXPVL]HUHJLVWHU %'0$5;/6= ,IWKLVELWLVVHWWKH%'0$5[EXIIHULVHPSW\ 7KLVELWLVVHWZKHQWKH%'0$UHFHLYHUKDVUHFHLYHGWKH OHQJWK(WKHUW\SHILHOGRIWKHFXUUHQWIUDPH 1RWDSSOLFDEOH 7KLVELWLVVHWZKHQHYHUDQDGGLWLRQDOGDWDIUDPHLV UHFHLYHGLQWKH%'0$UHFHLYHEXIIHU >@ >@ %'0$5[QRWRZQHU%5[12 %'0$5[PD[LPXPVL]HRYHU %5[062 %'0$5[EXIIHUHPSW\ %5[(PSW\ (DUO\QRWLILFDWLRQ%5[6(DUO\ 5HVHUYHG 2QHPRUHIUDPHGDWDLQ%'0$ UHFHLYHEXIIHU%5[)5) >@ >@ >@ >@ >@ >@ >@ 1XPEHURIIUDPHVLQ%'0$UHFHLYH 7KLVYDOXHLQGLFDWHVWKHWRWDOQXPEHURIGDWDIUDPHV EXIIHU%5[1)5 FXUUHQWO\LQWKH%'0$UHFHLYHEXIIHU %'0$7[FRPSOHWHWRVHQGFRQWURO %LW>@LVVHWHDFKWLPHWKH0$&VHQGVDFRPSOHWHFRQWURO SDFNHW%7[&&3 SDFNHW %'0$7[QXOOOLVW%7[1/ ,IWKLVELWLVVHWWKH%'0$7;375YDOXHLVDQXOODGGUHVV,Q WKLVFDVH%'0$7[LVGLVDEOHGEXWGDWDFRQWLQXHVWREH WUDQVIHUUHGIURPWKH%'0$7[EXIIHUWRWKH0$&7[),)2 XQWLOWKH%'0$7[EXIIHUXQGHUIORZV7KLVELWLVUHDGRQO\ ,I\RXVHW%'0$7[UHVHWELWE\VRIWZDUHWKLVELWLVFOHDUHG DXWRPDWLFDOO\7RUHVXPHGDWDWUDQVIHU\RXPXVWWKHQVHW WKHQHZIUDPHGHVFULSWRUSRLQWHUDQGHQDEOH%'0$7[ ,I>@LVVHW%'0$LVQRWRZQHURIWKHFXUUHQWIUDPH,QWKLV FDVHWKH%676.2ELWLVVHWDQG%'0$7[LVVWRSSHG 1RWDSSOLFDEOH 1RWDSSOLFDEOH >@ >@ >@ >@ %'0$7[QRWRZQHU%7[12 5HVHUYHG 5HVHUYHG %'0$7[EXIIHUHPSW\%7[(PSW\ ,IWKLVELWLVVHWWKH%'0$7[EXIIHULVHPSW\ (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 5(6(59(' % 7 % % % [ 7 7 7 ( [ [ [ [ P 1 1 & S 2 / & W 3 \ %5[1)5 % 5 % [ 5 [ [ 6 ( ) D 5 U ) O \ % 5 [ ( P S W \ % 5 [ 0 6 2 % 5 [ 1 2 % 5 [ 1 / % 5 [ 5 ' ) >@%'0$5[GRQHHYHU\UHFHLYHGIUDPH%5[5') 5HVHWIUDPHGDWDUHFHLYHVWDWH 5HFHLSWRIRQHGDWDIUDPHLVFRPSOHWH >@%'0$5[1XOOOLVW%5[1/ 5HVHWVWDWHRIQHZIUDPHGHVFULSWRU%'0$5;375LVVHW &XUUHQWIUDPHGHVFULSWRUDGGUHVVLV1XOO[ >@%'0$5[QRWRZQHU%5[12 %'0$LVRZQHURIWKHFXUUHQWIUDPH 7KHRZQHURIWKHFXUUHQWIUDPHLVQRW%'0$&38,QWKLVFDVH %'0$5[LVVWRSSHGDQGWKH%676.2ELWLVVHW >@%'0$5[PD[LPXPVL]HRYHU%5[062 5HVHWVWDWHRUQH[WIUDPHDUULYHGDW%'0$5[EXIIHU 5HFHLYHGIUDPHH[FHHGVWKHPD[LPXPIUDPHVL]H >@%'0$5[EXIIHUHPSW\%5[(PSW\ 1RWHPSW\ %'0$5[EXIIHUHPSW\ >@(DUO\QRWLI\%5[6(DUO\ 1RUPDORSHUDWLRQ /HQJWKRIFXUUHQWIUDPHFDQEHDFFHVVHGE\UHDGLQJWKH%'0$ UHFHLYHPD[LPXPIUDPHVL]HUHJLVWHU%'0$5;/6=>@ >@2QHPRUHIUDPHGDWDLQ%'0$UHFHLYHEXIIHU%5[)5) 2QO\RQHIUDPHGDWDLQ%'0$UHFHLYHEXIIHU 2QHPRUHIUDPHGDWDZDVLQWKH%'0$UHFHLYHEXIIHU >@1XPEHURIIUDPHGDWDLQ%'0$UHFHLYHEXIIHU%5[1)5 >@%'0$7[FRPSOHWHWRVHQGFRQWUROSDFNHW%7[&&3 &OHDUELWE\ZULWLQJDWRWKLVELWRUE\UHVHWWLQJ%'0$7[ 0$&FRPSOHWHWRVHQGWKHFRQWUROSDFNHW >@%'0$7[1XOOOLVW%7[1/ 5HVHWVWDWHRIQHZIUDPHGHVFULSWRU%'0$7;375LVVHW &XUUHQWIUDPHGHVFULSWRUDGGUHVVLV1XOO[ >@%'0$7[QRWRZQHU%7[12 %'0$LVRZQHURIWKHFXUUHQWIUDPH 7KHRZQHURIWKHFXUUHQWIUDPHLVQRW%'0$&38,QWKLV FDVH%'0$7[LVVWRSSHGLIWKH%7[676.2ELWLVVHWWRRQH >@5HVHUYHG >@%'0$7[EXIIHUHPSW\%7[(PSW\ 1RWHPSW\ %'0$7[EXIIHUHPSW\ >@5HVHUYHG 127( 7RFOHDUELWVDQG\RXPXVW ZULWHDWRWKHFRUUHVSRQGLQJELWORFDWLRQ )LJXUH%'0$6WDWXV5HJLVWHU .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 &RQWHQW$GGUHVV0HPRU\&$05HJLVWHU 7KHUHDUH&$0HQWULHVIRUWKHGHVWLQDWLRQDGGUHVVDQGWKH3DXVHFRQWUROSDFNHW)RUWKHGHVWLQDWLRQDGGUHVV &$0YDOXHRQHGHVWLQDWLRQDGGUHVVFRQVLVWVRIE\WHV8VLQJWKHZRUGVSDFHuE\WHV\RXFDQWKHUHIRUH PDLQWDLQXSWRVHSDUDWHGHVWLQDWLRQDGGUHVVHV <RXXVH&$0HQWULHVDQGWRVHQG3DXVHFRQWUROSDFNHWV7RVHQGD3DXVHFRQWUROSDFNHW\RXZULWHWKH &$0HQWU\ZLWKWKHGHVWLQDWLRQDGGUHVVWKH&$0HQWU\ZLWKWKHVRXUFHDGGUHVVDQGWKH&$0HQWU\ZLWK OHQJWKW\SHRSFRGHDQGRSHUDQG<RXWKHQVHWWKHVHQGSDXVHELWLQWKH0$&WUDQVPLWFRQWUROUHJLVWHU 7DEOH&$05HJLVWHU 5HJLVWHU &$0 2IIVHW$GGUHVV [ [& 5: : 'HVFULSWLRQ &$0FRQWHQWZRUGV 5HVHW9DOXH 8QGHILQHG 7DEOH&RQWHQW$GGUHVV0HPRU\&$05HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH &$0FRQWHQW&$0 'HVFULSWLRQ 7KH&38XVHVWKH&$0FRQWHQWUHJLVWHUDVDGDWDEDVHIRU GHVWLQDWLRQDGGUHVVV7RDFWLYDWHWKH&$0IXQFWLRQ\RX PXVWVHWWKHDSSURSULDWHHQDEOHELWVLQ&$0HQDEOH UHJLVWHU (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 0(',$$&&(66&21752/0$&5(*,67(56 7KLVVHFWLRQGHVFULEHVWKHFRQWURODQGVWDWXVUHJLVWHUVIRUWKHIORZFRQWURO0ELWV(WKHUQHW0$&7KHVH LQFOXGHDPDVWHU0$&FRQWUROUHJLVWHUFRQWUROUHJLVWHUVIRUWUDQVPLWDQGUHFHLYHFRQWUROUHJLVWHUVIRUWKH&$0D FRXQWHUIRUQHWZRUNPDQDJHPHQWDQGYDULRXVIORZFRQWUROUHJLVWHUVVHH7DEOH 7DEOH0$&&RQWURODQG6WDWXV5HJLVWHUV 5HJLVWHUV 0$&21 &$0&21 0$&7;&21 0$&7;67$7 0$&5;&21 0$&5;67$7 67$'$7$ 67$&21 &$0(1 (0,66&17 (3=&17 (503=&17 (7;67$7 2IIVHW [$ [$ [$ [$& [$ [$ [$ [$& [$ [$& [$ [$ [ 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5&OU : 5 5 5 0$&FRQWURO &$0FRQWURO 7UDQVPLWFRQWURO 7UDQVPLWVWDWXV 5HFHLYHFRQWURO 5HFHLYHVWDWXV 'HVFULSWLRQ 5HVHW9DOXH [ [ [ [ [ [ [ [ [ [ [ [ [ 6WDWLRQPDQDJHPHQWGDWD 6WDWLRQPDQDJHPHQWFRQWURODQGDGGUHVV &$0HQDEOH 0LVVHGHUURUFRXQW 3DXVHFRXQW 5HPRWHSDXVHFRXQW 7UDQVPLWFRQWUROIUDPHVWDWXV 127($0$&WUDQVPLWUHFHLYHLQWHUUXSWLVJHQHUDWHGZKHQHYHUWKH7[5[VWDWXVILHOGRI7[5[IUDPHGHVFULSWRULVZULWWHQ .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 0$&&RQWURO5HJLVWHU 7KH0$&FRQWUROUHJLVWHUSURYLGHVJOREDOFRQWURODQGVWDWXVLQIRUPDWLRQIRUWKH0$&7KHPLVVHGUROOOLQNELWLVD VWDWXVELW$OORWKHUELWVDUH0$&FRQWUROELWV 0$&FRQWUROUHJLVWHUVHWWLQJVDIIHFWERWKWUDQVPLVVLRQDQGUHFHSWLRQ<RXFDQDOVRFRQWUROWUDQVPLWDQGUHFHLYH RSHUDWLRQVVHSDUDWHO\7RVHOHFWFXVWRPL]HGRSHUDWLQJIHDWXUHV\RXVKRXOGZULWHWKLVUHJLVWHUGXULQJSRZHUXS7KLV ZD\\RXZLOOQRWQHHGWRZULWHRUUHDGLWDJDLQGXULQJQRUPDORSHUDWLRQ $IWHUDUHVHWLVFRPSOHWHWKH0$&FRQWUROOHUFOHDUVWKHUHVHWELW1RWDOO3+<VVXSSRUWIXOOGXSOH[RSHUDWLRQ 6HWWLQJWKH0$&ORRSEDFNELWRYHUULGHVWKHIXOOGXSOH[ELW$OVRVRPH0EV3+<VPD\LQWHUSUHWWKHORRSELW WRFRQWUROGLIIHUHQWIXQFWLRQVDQGPDQLSXODWHWKHOLQNELWWRLQGLFDWHDGLIIHUHQWVWDWXVFRQGLWLRQ 7DEOH0$&215HJLVWHU 5HJLVWHU 0$&21 2IIVHW$GGUHVV [$ 5: 5: 0$&FRQWURO 'HVFULSWLRQ 5HVHW9DOXH [ (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7DEOH0$&&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH +DOWUHTXHVW+DOW5HT 'HVFULSWLRQ 6HWWKLVELWWRVWRSGDWDSDFNHWWUDQVPLVVLRQDQGUHFHSWLRQ DVVRRQDV7[5[RIDQ\FXUUHQWSDFNHWVKDVEHHQ FRPSOHWHG 6HWWKLVELWWRLPPHGLDWHO\VWRSDOOWUDQVPLVVLRQDQG UHFHSWLRQ 6HWWKLVELWWRUHVHWDOO0$&FRQWURODQGVWDWXVUHJLVWHUDQG 0$&VWDWHPDFKLQHV 6HWWKLVELWWRVWDUWWUDQVPLVVLRQZKLOHUHFHSWLRQLVLQ SURJUHVV 6HWWKLVELWWRFDXVHWUDQVPLVVLRQVLJQDOVWREHSUHVHQWHG DVLQSXWWRWKHUHFHLYHFLUFXLWZLWKRXWOHDYLQJWKHFRQWUROOHU 1RWDSSOLFDEOH 8VHWKLVELWWRVHOHFWWKHFRQQHFWLRQPRGH,IWKLVELWLVVHWWR RQH0ELWVVLQWHUIDFHZLOOVHOHFWWKH0ELWVVHQGHF 2WKHUZLVHWKH0,,ZLOOEHVHOHFWHG ,IWKLVELWLVVHWWKH/RRSBH[WHUQDOVLJQDOLVDVVHUWHGWR WKH0EVHQGHF 1RWDSSOLFDEOH 7KLVELWLVDXWRPDWLFDOO\VHWZKHQWKHPLVVHGHUURUFRXQWHU UROOVRYHU 1RWDSSOLFDEOH &OHDUWKLVELWWRHQDEOHWKH0'&FORFNJHQHUDWLRQIRUSRZHU PDQDJHPHQW,ILWLVVHWWRRQHWKH0'&FORFNJHQHUDWLRQLV GLVDEOHG 6HWWKLVELWWRJHQHUDWHDQLQWHUUXSWZKHQHYHUWKHPLVVHG HUURUFRXQWHUUROOVRYHU 1RWDSSOLFDEOH 7KLVELWYDOXHLVUHDGDVDEXIIHUHGVLJQDORQWKHOLQNSLQ 1RWDSSOLFDEOH >@ >@ >@ >@ >@ >@ +DOWLPPHGLDWH+DOW,PP 6RIWZDUHUHVHW5HVHW )XOOGXSOH[)XOO'XS 0$&ORRSEDFN0$&/RRS 5HVHUYHG 0,,2)) >@ >@ >@ >@ >@ /RRS0EV/RRS 5HVHUYHG 0LVVHGUROO0LVV5ROO 5HVHUYHG 0'&2)) >@ >@ >@ >@ (QDEOHPLVVHGUROO(Q0LVV5ROO 5HVHUYHG /LQNVWDWXV0EV/LQN 5HVHUYHG .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 &$0&RQWURO5HJLVWHU 7KHWKUHHDFFHSWELWVLQWKH&$0FRQWUROUHJLVWHUDUHXVHGWRRYHUULGH&$0UHMHFWLRQV7RSODFHWKH0$&LQ SURPLVFXRXVPRGHXVH&$0FRQWUROUHJLVWHUVHWWLQJVWRDFFHSWSDFNHWVZLWKDOOWKUHHW\SHVRIGHVWLQDWLRQ DGGUHVVHV7KHWKUHHW\SHVRIGHVWLQDWLRQDGGUHVVSDFNHWVDUHDVIROORZV 6WDWLRQSDFNHWVZKLFKKDVDQHYHQILUVWE\WH)RUH[DPSOH $PXOWLFDVWJURXSZKLFKKDVDQRGGILUVWE\WHEXWZKLFKLVQRW)))))))))))))RUH[DPSOH $EURDGFDVWGHILQHGDV)))))))))))) :KHQ\RXHQDEOH&$0FRPSDUHPRGHWKH&$0PHPRU\UHDGVWKHGHVWLQDWLRQDGGUHVVHVWRILOWHULQFRPLQJ PHVVDJHV<RXZLOOUHFDOOWKDWWKH&$0PHPRU\FRQVLVWVRIE\WHHQWULHV$QDOWHUQDWLYHZD\WRSODFHWKH0$&LQ SURPLVFXRXVPRGHLVWRVHWLQWXUQWRDFFHSWWKHWKHP7RUHMHFWDOOSDFNHWVVLPSO\FOHDUDOORIWKHELWVLQWKH &$0&21UHJLVWHU 7DEOH&$0&215HJLVWHU 5HJLVWHU &$0&21 2IIVHW$GGUHVV [$ 5: 5: &$0FRQWURO 'HVFULSWLRQ 5HVHW9DOXH [ 7DEOH&$0&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ >@ >@ %LW1DPH 6WDWLRQDFFHSW6WDWLRQ$FF *URXSDFFHSW*URXS$FF %URDGFDVWDFFHSW%URDG$FF 1HJDWLYH&$01HJ&$0 'HVFULSWLRQ 6HWWKLVELWWRDFFHSWDQ\SDFNHWZLWKDXQLFDVWVWDWLRQ DGGUHVV $FFHSWDQ\SDFNHWZLWKDPXOWLFDVWJURXSDGGUHVV $FFHSWDQ\SDFNHWZLWKDEURDGFDVWDGGUHVV :KHQWKLVELWLVSDFNHWVWKH&$0UHFRJQL]HVDUH DFFHSWHGDQGRWKHUVDUHUHMHFWHG:KHQSDFNHWVWKH &$0UHFRJQL]HVDUHUHMHFWHGDQGRWKHUVDUHDFFHSWHG 6HWWKLVELWWRHQDEOHFRPSDUHPRGH 1RWDSSOLFDEOH >@ >@ &RPSDUHHQDEOH&RPS(Q 5HVHUYHG 0$&7UDQVPLW&RQWURO5HJLVWHU 7RJHQHUDWHDQLQWHUUXSWDIWHUHDFKSDFNHWVHWWKHHQDEOHFRPSOHWLRQELWDQGDOORIWKH0$&HUURUHQDEOHELWV8VLQJ 0$&WUDQVPLWFRQWUROUHJLVWHUVHWWLQJV\RXFDQDOVRVHOHFWLYHO\HQDEOHLQWHUUXSWVIRUVSHFLILFFRQGLWLRQV 7DEOH0$&7;&215HJLVWHU 5HJLVWHU 0$&7;&21 2IIVHW$GGUHVV [$ 5: 5: 7UDQVPLWFRQWURO 'HVFULSWLRQ 5HVHW9DOXH [ (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7DEOH0$&7UDQVPLW&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ >@ >@ >@ >@ >@ %LW1DPH 7UDQVPLWHQDEOH7[(Q 7UDQVPLWKDOWUHTXHVW7[+DOW 6XSSUHVVSDGGLQJ1R3DG 6XSSUHVV&5&1R&5& )DVWEDFNRII)%DFN 1RGHIHU1R'HI 6HQG3DXVH6G3DXVH 'HVFULSWLRQ 6HWWKLVELWWRHQDEOHWUDQVPLVVLRQ7RVWRSWUDQVPLVVLRQ LPPHGLDWHO\FOHDUWKHWUDQVPLWHQDEOHELWWR 6HWWKLVELWWRKDOWWUDQVPLVVLRQDIWHUFRPSOHWLQJDQ\FXUUHQW SDFNHW 6HWWRQRWJHQHUDWHSDGE\WHVIRUSDFNHWVRIOHVVWKDQ E\WHV 6HWWRVXSSUHVVDGGLWLRQRID&5&DWWKHHQGRIDSDFNHW 6HWWKLVELWWRXVHIDVWHUEDFNRIIWLPHVIRUWHVWLQJ 6HWWRGLVDEOHWKHGHIHUFRXQWHU7KHGHIHUFRXQWHUNHHSV FRXQWLQJXQWLOWKHFDUULHUVHQVH&U6ELWLVWXUQHGRII 6HWWKLVELWWRVHQGD3DXVHFRPPDQGRURWKHU0$&FRQWURO SDFNHW7KHVHQG3DXVHELWLVDXWRPDWLFDOO\FOHDUHGZKHQD FRPSOHWH0$&FRQWUROSDFNHWKDVEHHQWUDQVPLWWHG:ULWLQJ DWRWKLVUHJLVWHUELWKDVQRHIIHFW >@ >@ >@ 0,,0EV64(WHVWPRGHHQDEOH 6HWWKLVELWWRHQDEOH0,,0EV64(WHVWPRGH 64(Q (QDEOHXQGHUUXQ(Q8QGHU (QDEOHGHIHUUDO(Q'HIHU 6HWWKLVELWWRJHQHUDWHDQLQWHUUXSWLIWKH0$&WUDQVPLW ),)2LVHPSW\GXULQJDWUDQVPLVVLRQ 6HWWKLVELWWRJHQHUDWHDQLQWHUUXSWLIWKH0$&GHIHUVIRU 0$;B'()(55$/WLPH PVDW0EV PVDW0EV 6HWWKLVELWWRJHQHUDWHDQLQWHUUXSWLIDFDUULHUVHQVHLVQRW GHWHFWHGZKLOHDQHQWLUHSDFNHWLVWUDQVPLWWHG 6HWWKLVELWWRHQDEOHDQLQWHUUXSWLIFROOLVLRQVRFFXULQWKH VDPHSDFNHW 6HWWKLVELWWRJHQHUDWHDQLQWHUUXSWLIDFROOLVLRQRFFXUVDIWHU ELWWLPHVRUE\WHWLPHV 6HWWKLVELWWRJHQHUDWHDQLQWHUUXSWLIDSDULW\HUURULV GHWHFWHGLQWKH0$&WUDQVPLW),)2 6HWWKLVELWWRJHQHUDWHDQLQWHUUXSWZKHQHYHUWKH0$& WUDQVPLWVRUGLVFDUGVRQHSDFNHW 1RWDSSOLFDEOH >@ >@ >@ >@ >@ >@ (QDEOHQRFDUULHU(Q1&DUU (QDEOHH[FHVVLYHFROOLVLRQ (Q([&ROO (QDEOHODWHFROOLVLRQ(Q/DWH&ROO (QDEOHWUDQVPLWSDULW\(Q7[3DU (QDEOHFRPSOHWLRQ(Q&RPS 5HVHUYHG .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 0$&7UDQVPLW6WDWXV5HJLVWHU $WUDQVPLVVLRQVWDWXVIODJLVVHWLQWKHWUDQVPLWVWDWXVUHJLVWHU0$&7;67$7ZKHQHYHUWKHFRUUHVSRQGLQJHYHQW RFFXUV,QDGGLWLRQDQLQWHUUXSWLVJHQHUDWHGLIWKHFRUUHVSRQGLQJHQDEOHELWLQWKHWUDQVPLWFRQWUROUHJLVWHULVVHW $0$&WUDQVPLW),)2SDULW\HUURUVHWV7[3DUDQGDOVRFOHDUV7[(QLIWKHLQWHUUXSWLVHQDEOHG <RXFDQUHDGDQGPDVNWKHILYHORZRUGHUELWVDVDVLQJOHFROOLVLRQFRXQW7KDWLVZKHQ([&ROOLV7[&ROOLV ,I7[&ROOLVQRWWKHQ([&ROOLV 7DEOH0$&7;67$75HJLVWHU 5HJLVWHU 0$&7;67$7 2IIVHW$GGUHVV [$& 5: 5: 7UDQVPLWVWDWXV 'HVFULSWLRQ 5HVHW9DOXH [ (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7DEOH0$&7UDQVPLW6WDWXV5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ >@ >@ >@ >@ >@ %LW1DPH 7UDQVPLWFROOLVLRQFRXQW7[&ROO ([FHVVLYHFROOLVLRQ([&ROO 7UDQVPLWGHIHUUHG7['HIHUUHG 3DXVHG3DXVHG ,QWHUUXSWRQWUDQVPLW,QW7[ 8QGHUUXQ8QGHU 'HIHUUDO'HIHU 'HVFULSWLRQ 7KLVELWYDOXHLVWKHFRXQWRIFROOLVLRQVWKDWRFFXUUHGZKLOH VXFFHVVIXOO\WUDQVPLWWLQJWKHSDFNHW 7KLVELWLVVHWLIFROOLVLRQVRFFXUZKLOHWUDQVPLWWLQJWKH VDPHSDFNHW,QWKLVFDVHSDFNHWWUDQVPLVVLRQLVDERUWHG 7KLVELWLVVHWLIWUDQVPLVVLRQRIDSDFNHWZDVGHIHUUHG EHFDXVHRIDGHOD\GXULQJWUDQVPLVVLRQ 7KLVELWLVVHWLIWUDQVPLVVLRQRIDSDFNHWZDVGHOD\HGGXH WRD3DXVHEHLQJUHFHLYHG 7KLVELWLVVHWLIWUDQVPLVVLRQRIDSDFNHWFDXVHVDQLQWHUUXSW FRQGLWLRQ 7KLVELWLVVHWLIWKH0$&WUDQVPLW),)2EHFRPHVHPSW\ GXULQJDSDFNHWWUDQVPLVVLRQ 7KLVELWLVVHWLIWKH0$&GHIHUVDWUDQVIHUEHFDXVHRI 0$;B'()(55$/DWPVIRU0EVRU PVIRU0EV 7KLVELWLVVHWLIQRFDUULHUVHQVHLVGHWHFWHGGXULQJWKH WUDQVPLVVLRQDSDFNHW $FFRUGLQJWRWKH,(((UXOHWKH64(VLJQDOUHSRUWV WKHVWDWXVRIWKH30$0$8RUWUDQVFHLYHURSHUDWLRQWRWKH 0$&OD\HU$IWHUWUDQVPLVVLRQLVFRPSOHWHDQGPVKDV HODSVHGDFROOLVLRQGHWHFWLRQVLJQDOLVLVVXHGIRUPVWR WKH0$&OD\HU7KLVVLJQDOLVFDOOHGWKH64(WHVWVLJQDO 7KH0$&VHWVWKH64(ELWLQWKH0$&7;67$7UHJLVWHULI WKLVVLJQDOLVQRWUHSRUWHGZLWKLQWKH,)*WLPHRIPV 7KLVELWLVVHWLIDFROOLVLRQRFFXUVDIWHUELWWLPHVRU E\WHWLPHV 7KLVELWLVVHWLIDSDULW\HUURULVGHWHFWHGLQWKH0$& WUDQVPLW),)2 7KLVELWLVVHWZKHQWKH0$&WUDQVPLWVRUGLVFDUGVRQH SDFNHW 7UDQVPLVVLRQZDVKDOWHGE\FOHDULQJWKH7[(QELWRUWKHKDOW LPPHGLDWH+DOW,PPELW 1RWDSSOLFDEOH >@ >@ 1RFDUULHU1&DUU 6LJQDOTXDOLW\HUURU64( >@ >@ >@ >@ >@ /DWHFROOLVLRQ/DWH&ROO 7UDQVPLWSDULW\HUURU7[3DU &RPSOHWLRQ&RPS 7UDQVPLVVLRQKDOWHG7[+DOWHG 5HVHUYHG .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 0$&5HFHLYH&RQWURO5HJLVWHU 7RLVVXHDQLQWHUUXSWDIWHUHDFKSDFNHWLVUHFHLYHGVHWWKHHQDEOHJRRGELWDQGDOORIWKHHUURUHQDEOHELWVLQWKH 0$&5;&21UHJLVWHU<RXFDQDOVRHQDEOHLQWHUUXSWVIRUVSHFLILFFRQGLWLRQV6WDQGDUGSDFNHWOHQJWKYDOXHVGRQRW LQFOXGHDSUHDPEOHRUDVWDUWIUDPHGHOLPLWHU6)' 7DEOH0$&5;&215HJLVWHU 5HJLVWHU 0$&5;&21 2IIVHW$GGUHVV [$ 5: 5: 5HFHLYHFRQWURO 'HVFULSWLRQ 5HVHW9DOXH [ (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7DEOH0$&5HFHLYH&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ >@ >@ >@ >@ >@ >@ >@ %LW1DPH 5HFHLYHHQDEOH5[(Q 5HFHLYHKDOWUHTXHVW5[+DOW /RQJHQDEOH/RQJ(Q 6KRUWHQDEOH6KRUW(Q 6WULS&5&YDOXH6WULS&5& 3DVVFRQWUROSDFNHW3DVV&WO ,JQRUH&5&YDOXH,JQRUH&5& 5HVHUYHG (QDEOHDOLJQPHQW(Q$OLJQ 'HVFULSWLRQ 6HWWKLVELWWRWRHQDEOH0$&UHFHLYHRSHUDWLRQ,I VWRSUHFHSWLRQLPPHGLDWHO\ 6HWWKLVELWWRKDOWUHFHSWLRQDIWHUFRPSOHWLQJWKHUHFHSWLRQ RIDQ\FXUUHQWSDFNHW 6HWWKLVELWWRUHFHLYHIUDPHVZLWKOHQJWKVJUHDWHUWKDQ E\WHV 6HWWKLVELWWRUHFHLYHIUDPHVZLWKOHQJWKVOHVVWKDQ E\WHV 6HWWKLVELWWRFKHFNWKH&5&DQGWKHQVWULSLWIURPWKH PHVVDJH 6HWWKLVELWWRHQDEOHWKHSDVVLQJRIFRQWUROSDFNHWVWRD 0$&FOLHQW 6HWWKLVELWWRGLVDEOH&5&YDOXHFKHFNLQJ 1RWDSSOLFDEOH 6HWWKLVELWWRHQDEOHWKHDOLJQPHQWLQWHUUXSW$QDOLJQPHQW LQWHUUXSWRFFXUVZKHQDSDFNHWLVUHFHLYHGZKRVHOHQJWKLQ ELWVLVQRWDPXOWLSOHRIHLJKWDQGZKRVH&5&LVLQYDOLG 6HWWKLVELWWRHQDEOHWKH&5&LQWHUUXSW$&5&LQWHUUXSW RFFXUVZKHQDSDFNHWLVUHFHLYHGZKRVH&5&LVLQYDOLGRU LIGXULQJLWVUHFHSWLRQWKH3+<DVVHUWV5[BHU 6HWWKLVELWWRHQDEOHWKHRYHUIORZLQWHUUXSW$QRYHUIORZ LQWHUUXSWLVJHQHUDWHGZKHQDSDFNHWLVUHFHLYHGDQGWKH 0$&UHFHLYH),)2LVIXOO 6HWWKLVELWWRHQDEOHWKHORQJHUURULQWHUUXSW$ORQJHUURU LQWHUUXSWLVJHQHUDWHGZKHQDIUDPHORQJHUWKDQE\WHV LVUHFHLYHGXQOHVVWKHORQJHQDEOHELWLVVHW 1RWDSSOLFDEOH 6HWWKLVELWWRHQDEOHDUHFHLYHSDULW\LQWHUUXSWLIWKH0$& UHFHLYH),)2GHWHFWVDSDULW\HUURU 6HWWKLVELWWRHQDEOHWKHJRRGSDFNHWLQWHUUXSWXSRQHUURU IUHHUHFHSWLRQRIDFRPSOHWHGDWDSDFNHW 1RWDSSOLFDEOH >@ (QDEOH&5&HUURU(Q&5&(UU >@ (QDEOHRYHUIORZ(Q2YHU >@ (QDEOHORQJHUURU(Q/RQJ(UU >@ >@ >@ >@ 5HVHUYHG (QDEOHUHFHLYHSDULW\(Q5[3DU (QDEOH*RRG(Q*RRG 5HVHUYHG 127( 7KHIUDPHOHQJWKVJLYHQDERYHGRQRWLQFOXGHSUHDPEOHDQGVWDUWIUDPHGHOLPLWHU6)' .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 0$&5HFHLYH6WDWXV5HJLVWHU $UHFHLYHVWDWXVIODJLVVHWLQWKH0$&UHFHLYHVWDWXVUHJLVWHU0$&5;67$7ZKHQHYHUWKHFRUUHVSRQGLQJHYHQW RFFXUV:KHQDVWDWXVIODJLVVHWLWUHPDLQVVHWXQWLODQRWKHUSDFNHWDUULYHVRUXQWLOVRIWZDUHZULWHVDWRWKHIODJ WRFOHDUWKHVWDWXVELW,IWKHFRUUHVSRQGLQJLQWHUUXSWHQDEOHELWLQWKHUHFHLYHFRQWUROUHJLVWHULVVHWDQLQWHUUXSWLV JHQHUDWHGZKHQHYHUDVWDWXVIODJLVVHW$0$&UHFHLYHSDULW\HUURUVHWV5[3DUDQGDOVRFOHDUVWKH5[(QELWLIDQ LQWHUUXSWLVHQDEOHG 7DEOH0$&5;67$75HJLVWHU 5HJLVWHU 0$&5;67$7 2IIVHW$GGUHVV [$ 5: 5: 5HFHLYHVWDWXV 'HVFULSWLRQ 5HVHW9DOXH [ (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7DEOH0$&5HFHLYH6WDWXV5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ 5HVHUYHG &RQWUROIUDPHUHFHLYHG&WO5HFG %LW1DPH 1RWDSSOLFDEOH 7KLVELWLVVHWLIWKHSDFNHWUHFHLYHGLVD0$&FRQWUROIUDPH W\SH +LIWKH&$0UHFRJQL]HVWKHSDFNHWDGGUHVV DQGLIWKHIUDPHOHQJWKLVE\WHV 7KLVELWLVVHWLIWKHUHFHSWLRQRIDSDFNHWFDXVHGDQ LQWHUUXSWWREHJHQHUDWHG7KLVLQFOXGHVDJRRGUHFHLYHG LQWHUUXSWLIWKH(Q*RRGELWLVVHW 7KLVELWLVVHWWRLIDSDFNHWZDVUHFHLYHGRYHUWKH 0EVLQWHUIDFHRUWRLIDSDFNHWZDVUHFHLYHGRYHUWKH 0,, 7KLVELWLVVHWLIWKHIUDPHOHQJWKLQELWVZDVQRWDPXOWLSOHRI HLJKWDQGWKH&5&ZDVLQYDOLG 7KLVELWLVVHWLIWKH&5&DWWKHHQGRIDSDFNHWGLGQRW PDWFKWKHFRPSXWHGYDOXHRUHOVHWKH3+<DVVHUWHG5[BHU GXULQJSDFNHWUHFHSWLRQ 7KLVELWLVVHWLIWKH0$&UHFHLYH),)2ZDVIXOOZKHQLW QHHGHGWRVWRUHDUHFHLYHGE\WH 7KLVELWLVVHWLIWKH0$&UHFHLYHGDIUDPHORQJHUWKDQ E\WHV,WLVQRWVHWLIWKHORQJHQDEOHELWLQWKHUHFHLYH FRQWUROUHJLVWHU0$&5;&21LVVHW 1RWDSSOLFDEOH 7KLVELWLVVHWLIDSDULW\HUURULVGHWHFWHGLQWKH0$&UHFHLYH ),)2 7KLVELWLVVHWLIDSDFNHWZDVVXFFHVVIXOO\UHFHLYHGZLWKQR HUURUV,I(Q*RRG DQLQWHUUXSWLVDOVRJHQHUDWHG 7KLVELWLVVHWLIUHFHSWLRQZDVKDOWHGE\FOHDULQJ5[(QRUE\ VHWWLQJWKH+DOW,PPELWLQWKH0$&FRQWUROUHJLVWHU 0$&21 1RWDSSOLFDEOH 'HVFULSWLRQ >@ ,QWHUUXSWRQUHFHLYH,QW5[ >@ 5HFHLYH0EVVWDWXV5[6WDW >@ >@ $OLJQPHQWHUURU$OLJQ(UU &5&HUURU&5&(UU >@ >@ 2YHUIORZHUURURYHUIORZ /RQJHUURU/RQJ(UU >@ >@ >@ >@ 5HVHUYHG 5HFHLYHSDULW\HUURU5[3DU *RRGUHFHLYHG*RRG 5HFHSWLRQKDOWHG5[+DOWHG >@ 5HVHUYHG .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 0$&6WDWLRQ0DQDJHPHQW'DWD5HJLVWHU 7DEOH67$'$7$5HJLVWHU 5HJLVWHU 67$'$7$ 2IIVHW$GGUHVV [$ 5: 5: 'HVFULSWLRQ 6WDWLRQPDQDJHPHQWGDWD 5HVHW9DOXH [ 7DEOH0$&6WDWLRQ0DQDJHPHQW5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 6WDWLRQPDQDJHPHQWGDWD 'HVFULSWLRQ 7KLVUHJLVWHUFRQWDLQVDELWGDWDYDOXHIRUWKHVWDWLRQ PDQDJHPHQWIXQFWLRQ (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 0$&6WDWLRQ0DQDJHPHQW'DWD&RQWURODQG$GGUHVV5HJLVWHU 7KH0$&FRQWUROOHUSURYLGHVVXSSRUWIRUUHDGLQJDQGZULWLQJVWDWLRQPDQDJHPHQWGDWDWRWKH3+<6HWWLQJRSWLRQV LQVWDWLRQPDQDJHPHQWUHJLVWHUVGRHVQRWDIIHFWWKHFRQWUROOHU6RPH3+<VPD\QRWVXSSRUWWKHRSWLRQWRVXSSUHVV SUHDPEOHVDIWHUWKHILUVWRSHUDWLRQ 7DEOH67$&215HJLVWHU 5HJLVWHU 67$&21 2IIVHW$GGUHVV [$& 5: 5: 'HVFULSWLRQ 6WDWLRQPDQDJHPHQWFRQWURODQGDGGUHVV 5HVHW9DOXH [ 7DEOH67$&215HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ >@ >@ %LW1DPH 3+<UHJLVWHUDGGUHVV$GGU 3+<DGGUHVV3+< :ULWH:U %XV\ELW%XV\ 'HVFULSWLRQ $ELWDGGUHVVFRQWDLQHGLQWKH3+<RIWKHUHJLVWHUWREH UHDGRUZULWWHQ 7KHELWDGGUHVVRIWKH3+<GHYLFHWREHUHDGRUZULWWHQ 7RLQLWLDWHDZULWHRSHUDWLRQVHWWKLVELWWR)RUDUHDG RSHUDWLRQFOHDULWWR 7RVWDUWDUHDGRUZULWHRSHUDWLRQVHWWKLVELWWR7KH 0$&FRQWUROOHUFOHDUVWKH%XV\ELWDXWRPDWLFDOO\ZKHQWKH RSHUDWLRQLVFRPSOHWHG ,I\RXVHWWKLVELWWKHSUHDPEOHLVQRWVHQWWRWKH3+<,ILWLV FOHDUWKHSUHDPEOHLVVHQW &RQWUROWKH0'&SHULRG 0'B&$>@0'&SHULRG uI0&/. uI0&/. uI0&/. >@ >@ 3UHDPEOHVXSSUHVV3UH6XS 0'&FORFNUDWLQJ uI0&/. 0'&SHULRG 0'B&$>@u 'HIDXOW0'&B&$>@ >@ 5HVHUYHG 1RWDSSOLFDEOH .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 &$0(QDEOH5HJLVWHU 7KH&$0HQDEOHUHJLVWHU&$0(1LQGLFDWHVZKLFK&$0HQWULHVDUHYDOLGXVLQJDGLUHFWFRPSDULVRQPRGH8SWR HQWULHVQXPEHUHGWKURXJKPD\EHDFWLYHGHSHQGLQJRQWKH&$0VL]H,IWKH&$0LVVPDOOHUWKDQ HQWULHVWKHKLJKHUELWVDUHLJQRUHG 7DEOH&$0(15HJLVWHU 5HJLVWHU &$0(1 2IIVHW$GGUHVV [$ 5: 5: &$0HQDEOH 'HVFULSWLRQ 5HVHW9DOXH [ 7DEOH&$0(QDEOH5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH &$0HQDEOH&$0(Q 'HVFULSWLRQ 6HWWKHELWVLQWKLVELWYDOXHWRVHOHFWLYHO\HQDEOH&$0 ORFDWLRQVWKURXJK7RGLVDEOHD&$0ORFDWLRQFOHDUWKH DSSURSULDWHELW 1RWDSSOLFDEOH >@ 5HVHUYHG (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 0$&0LVVHG(UURU&RXQW5HJLVWHU 7KHYDOXHLQWKHPLVVHGHUURUFRXQWUHJLVWHU(0,66&17LQGLFDWHVWKHQXPEHURISDFNHWVWKDWZHUHGLVFDUGHGGXH WRYDULRXVW\SHRIHUURUV7RJHWKHUZLWKVWDWXVLQIRUPDWLRQRQSDFNHWVWUDQVPLWWHGDQGUHFHLYHGWKHPLVVHGHUURU FRXQWUHJLVWHUDQGWKHWZR3DXVHFRXQWUHJLVWHUVSURYLGHWKHLQIRUPDWLRQUHTXLUHGIRUVWDWLRQPDQDJHPHQW 5HDGLQJWKHPLVVHGHUURUFRXQWHUUHJLVWHUFOHDUVWKHUHJLVWHU,WLVWKHQWKHUHVSRQVLELOLW\RIVRIWZDUHWRPDLQWDLQD JOREDOFRXQWZLWKPRUHELWVRISUHFLVLRQ 7KHFRXQWHUUROOVRYHUIURP[)))WR[DQGVHWVWKHFRUUHVSRQGLQJELWLQWKH0$&FRQWUROUHJLVWHU,WDOVR JHQHUDWHVDQLQWHUUXSWLIWKHFRUUHVSRQGLQJLQWHUUXSWHQDEOHELWLVVHW,IVWDWLRQPDQDJHPHQWVRIWZDUHZDQWVPRUH IUHTXHQWLQWHUUXSWV\RXFDQVHWWKHPLVVHGHUURUFRXQWUHJLVWHUWRDYDOXHFORVHUWRWKHUROORYHUYDOXHRI[))))RU H[DPSOHVHWWLQJDUHJLVWHUWR[)ZRXOGJHQHUDWHDQLQWHUUXSWZKHQWKHFRXQWYDOXHUHDFKHVRFFXUUHQFHV 7DEOH(0,66&175HJLVWHU 5HJLVWHU (0,66&17 2IIVHW$GGUHVV [$& 5: 5&OU : 'HVFULSWLRQ 0LVVHGHUURUFRXQW 5HVHW9DOXH [ 7DEOH0LVVHG(UURU&RXQW5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 'HVFULSWLRQ $OLJQPHQWHUURUFRXQW$OLJQ(UU&QW 7KHQXPEHURISDFNHWVUHFHLYHGZLWKDOLJQPHQWHUURUV7KLV VRIWZDUHFRXQWHULQFUHPHQWVDWWKHHQGRIDSDFNHW UHFHSWLRQLIWKH5[B6WDWYDOXHLQGLFDWHVDQDOLJQPHQWHUURU &5&HUURUFRXQW&5&(UU&QW 7KHQXPEHURISDFNHWVUHFHLYHGZLWKD&5&HUURU7KLV VRIWZDUHFRXQWHULQFUHPHQWVLIWKH5[B6WDWYDOXHLQGLFDWHV D&5&HUURU,IWKH5[B6WDWYDOXHLQGLFDWHVDQRWKHUW\SHRI HUURUVXFKDVDQDOLJQPHQWHUURUWKLVFRXQWHULVQRW LQFUHPHQWHG 7KHQXPEHURIYDOLGSDFNHWVUHMHFWHGE\WKH0$&XQLW EHFDXVHRI0$&UHFHLYH),)2RYHUIORZVSDULW\HUURUVRU EHFDXVHWKH5[B(QELWZDVFOHDUHG7KLVFRXQWGRHVQRW LQFOXGHWKHQXPEHURISDFNHWVUHMHFWHGE\WKH&$0 1RWDSSOLFDEOH 0LVVHGHUURUFRXQW0LVV(UU&QW >@ 5HVHUYHG .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 0$&5HFHLYHG3DXVH&RXQW5HJLVWHU 7KHUHFHLYHG3DXVHFRXQWUHJLVWHU(3=&17VWRUHVWKHFXUUHQWYDOXHRIWKHELWUHFHLYHG3DXVHFRXQWHU 7DEOH(3=&175HJLVWHU 5HJLVWHU (3=&17 2IIVHW$GGUHVV [$ 5: 5 3DXVHFRXQW 'HVFULSWLRQ 5HVHW9DOXH [ 7DEOH5HFHLYHG3DXVH&RXQW5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 5HFHLYHG3DXVHFRXQW(3=&17 'HVFULSWLRQ 7KHFRXQWYDOXHLQGLFDWHVWKHQXPEHURIWLPHVORWVWKH WUDQVPLWWHUZDVSDXVHGGXHWRWKHUHFHLSWRIFRQWURO3DXVH RSHUDWLRQSDFNHWVIURPWKH0$& 0$&5HPRWH3DXVH&RXQW5HJLVWHU 7KHUHPRWH3DXVHFRXQWUHJLVWHU(503=&17VWRUHVWKHFXUUHQWYDOXHRIWKHELWUHPRWH3DXVHFRXQWHU 7DEOH(503=&175HJLVWHU 5HJLVWHU (503=&17 2IIVHW$GGUHVV [$ 5: 5 'HVFULSWLRQ 5HPRWHSDXVHFRXQW 5HVHW9DOXH [ 7DEOH5HPRWH3DXVH&RXQW5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 5HPRWH3DXVHFRXQW (503=&17 'HVFULSWLRQ 7KHFRXQWYDOXHLQGLFDWHVWKHQXPEHURIWLPHVORWVWKDWD UHPRWH0$&ZDVSDXVHGDVDUHVXOWRILWVVHQGLQJFRQWURO 3DXVHRSHUDWLRQSDFNHWV (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 0$&7UDQVPLW&RQWURO)UDPH6WDWXV 7KHWUDQVPLWFRQWUROIUDPHVWDWXVUHJLVWHU(7;67$7LVD5$0EDVHGUHJLVWHUZKLFKSURYLGHVWKHVWDWXVRID0$& FRQWUROSDFNHWDVLWLVVHQWWRDUHPRWHVWDWLRQ7KLVRSHUDWLRQLVFRQWUROOHGE\WKH6G3DXVHELWLQWKHWUDQVPLWFRQWURO UHJLVWHU0$&7;&21 ,WLVWKHUHVSRQVLELOLW\RIWKH'0$HQJLQHWRUHDGWKLVUHJLVWHUDQGWRJHQHUDWHDQLQWHUUXSWWRQRWLI\WKHV\VWHPWKDW WKHWUDQVPLVVLRQRID0$&FRQWUROSDFNHWKDVEHHQFRPSOHWHG 7DEOH(7;67$75HJLVWHU 5HJLVWHU (7;67$7 2IIVHW$GGUHVV [ 5: 5 'HVFULSWLRQ 7UDQVPLWFRQWUROIUDPHVWDWXV 5HVHW9DOXH [ 7DEOH7UDQVPLW&RQWURO)UDPH5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 7[B6WDWYDOXH 'HVFULSWLRQ $ELWYDOXHLQGLFDWLQJWKHVWDWXVRID0$&FRQWUROSDFNHW DVLWLVVHQWWRDUHPRWHVWDWLRQ5HDGE\WKH'0$HQJLQH .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 (7+(51(7&21752//(523(5$7,216 7KLVVHFWLRQFRQWDLQVDGGLWLRQDOGHWDLOVDERXWWKHIROORZLQJRSHUDWLRQVRIWKH.6&(WKHUQHWFRQWUROOHU 0$&IUDPHDQGSDFNHWIRUPDWV 7UDQVPLWWLQJDIUDPH 5HFHLYLQJDIUDPH )XOOGXSOH[3DXVHRSHUDWLRQ (UURUVLJQDOLQJDQGQHWZRUNPDQDJHPHQW 0$&)UDPHDQG3DFNHW)RUPDWV 7KH0$&WUDQVPLWVHDFKE\WHRIDOOILHOGVH[FHSWWKH)&6OHDVWVLJQLILFDQWELWILUVW,QWKLVGRFXPHQWWKHWHUP SDFNHWLVXVHGWRGHQRWHDOORIWKHE\WHVWKDWDUHWUDQVPLWWHGDQGUHFHLYHGZKLOHIUDPHUHIHUVRQO\WRWKHE\WHV GHOLYHUHGE\WKHVWDWLRQIRUWUDQVPLVVLRQDQGWRWKHVWDWLRQZKRLVUHFHLYLQJ 7DEOHOLVWVWKHHLJKWILHOGVLQDVWDQGDUGGDWDSDFNHW,((((WKHUQHWIUDPH6HHDOVR)LJXUH 7DEOH0$&)UDPHDQG3DFNHW)RUPDW'HVFULSWLRQ )LHOG1DPH 3UHDPEOH 6WDUWIUDPHGHOLPLWHU6)' 'HVWLQDWLRQDGGUHVV 6RXUFHDGGUHVV )LHOG6L]H E\WHV E\WH E\WHV E\WHV 'HVFULSWLRQ 7KHELWVLQHDFKSUHDPEOHE\WHDUHWUDQVPLWWHG IURPOHIWWRULJKW 7KH6)'ELWVDUHWUDQVPLWWHGIURPOHIWWRULJKW 7KHGHVWLQDWLRQDGGUHVVFDQEHDQLQGLYLGXDODGGUHVVRUD PXOWLFDVWRUEURDGFDVWDGGUHVV 7KH0$&GRHVQRWLQWHUSUHWWKHVRXUFHDGGUHVVE\WHV +RZHYHUWRTXDOLI\DVDYDOLGVWDWLRQDGGUHVVWKHILUVWELW WUDQVPLWWHGWKH/6%RIWKHILUVWE\WHPXVWEHD 7KH0$&WUHDWVOHQJWKILHOGVJUHDWHUWKDQE\WHVDV W\SHILHOGV%\WHYDOXHVOHVVWKDQRUHTXDOWRLQGLFDWH WKHQXPEHURIORJLFDOOLQNFRQWURO//&GDWDE\WHVLQWKH GDWDILHOG7KH0$&WUDQVPLWVWKHKLJKRUGHUE\WHILUVW 'DWDE\WHVXVHGIRUORJLFDOOLQNFRQWURO ,IWKH//&GDWDLVOHVVWKDQE\WHVORQJWKH0$& WUDQVPLWVSDGE\WHVRIDOO]HURV 7KH)&6ILHOGFRQWDLQVDELWHUURUGHWHFWLRQFRGHWKDWLV FRPSXWHGDVDIXQFWLRQRIDOOILHOGVH[FHSWWKHSUHDPEOH WKH6)'DQGWKH)&6LWVHOI7KH)&6SRO\QRPLDO IXQFWLRQLVDVIROORZV;;;;; ;;;;;;;; /HQJWKRUW\SH E\WHV /RJLFDOOLQNFRQWURO//&GDWD 3$' )UDPHFKHFNVHTXHQFH)&6 WRE\WHV WRE\WHV E\WHV (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 3$&.(7(1&2'('217+( 0(',80 $''('%< 75$160,77(5 675,33('%< 5(&(,9(5 6 ) ' '$7$)5$0(6(17%<86(5 $''('%<75$160,77(5 '$7$)5$0('(/,9(5('7286(5 237,21$/<675,33(' %<5(&(,9(5 35($0%/( '(67,1$7,21 $''5(66 %<7(6 6285&( $''5(66 %<7(6 /(1*7+ 25 7<3( %<7(6 //&'$7$ 3$' )&6 %,7 %<7(6 %<7(6 //&+($'(5 '6$3 25 '6$3 66$3 %<7( //&,1)250$7,21),(/' ,3; 61$3 66$3 &75/ &75/ %<7( 28, 3,' ,3; %<7( %<7(6 %<7(6 '6$3 'HVWLQDWLRQVHUYLFHDFFHVVSRLQW &75/ &RQWUROILHOG 28, 2UJDQL]DWLRQDOO\XQLTXHLGHQWLILHU 6)' 6WDUWLQJIUDPHGHOLPLWHU 66$3 6RXUFHVHUYLFHDFFHVVSRLQW 61$3 6XEQHWZRUNDFFHVVSURWRFRO 3,' 3URWRFROLGHQWLILHU //& /RJLFDOOLQNFRQWURO )&6 )UDPHFKHFNVHTXHQFH )LJXUH)LHOGVRIDQ,((((WKHUQHW3DFNHW)UDPH 2SWLRQV7KDW$IIHFWWKH6WDQGDUG0$&)UDPH 7KHUHDUHDQXPEHURIIDFWRUVDQGRSWLRQVZKLFKFDQDIIHFWWKHVWDQGDUG0$&IUDPHDVGHVFULEHGLQ7DEOH 6RPH3+<VPD\GHOLYHUDORQJHURUVKRUWHUSUHDPEOH 6KRUWSDFNHWPRGHSHUPLWV//&GDWDILHOGVZLWKOHVVWKDQE\WHV2SWLRQVDUHDYDLODEOHWRVXSSUHVVSDGGLQJ DQGWRVXSSRUWWKHUHFHSWLRQRIVKRUWSDFNHWV /RQJSDFNHWPRGHVXSSRUWV//&GDWDILHOGVZLWKPRUHWKDQE\WHV$QRSWLRQLVDOVRDYDLODEOHWRVXSSRUWWR UHFHSWLRQRIORQJSDFNHWV 1R&5&PRGHVXSSUHVVHVWKHDSSHQGLQJRID&5&ILHOG ,JQRUH&5&PRGHDOORZVWKHUHFHSWLRQRISDFNHWVZLWKRXWYDOLG&5&ILHOGV .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 'HVWLQDWLRQ$GGUHVV)RUPDW %LWRIWKHGHVWLQDWLRQDGGUHVVLVDQDGGUHVVW\SHGHVLJQDWLRQELW,WLGHQWLILHVWKHDGGUHVVDVHLWKHUDQLQGLYLGXDORU DJURXSDGGUHVV*URXSDGGUHVVHVDUHVRPHWLPHVFDOOHGPXOWLFDVWDGGUHVVHVDQGLQGLYLGXDODGGUHVVHVDUHFDOOHG XQLFDVWDGGUHVVHV7KHEURDGFDVWDGGUHVVLVDVSHFLDOJURXSDGGUHVVLQWKHVSHFLDOKH[IRUPDW)))))))))) )) %LWRIWKHGHVWLQDWLRQDGGUHVVGLVWLQJXLVKHVEHWZHHQORFDOO\RUJOREDOO\DGPLQLVWHUHGDGGUHVVHV)RUJOREDOO\ DGPLQLVWHUHGRUXQLYHUVDO8DGGUHVVHVWKHELWYDOXHLV,IDQDGGUHVVLVWREHDVVLJQHGORFDOO\\RXPXVWVHW WKLVELWWR)RUWKHEURDGFDVWDGGUHVVWKLVELWPXVWDOVREHVHWWR '(67,1$7,21$''5(66 %/2&.,'RU28,%<7(6 0$&$''5(66%<7(6 8/ ,* >@,QGLYLGXDORUJURXSIODJ,* ,QGLYLGXDO XQLFDVWDGGUHVV *URXS PXOWLFDVWDGGUHVV 8QLYHUVDODGGUHVV /RFDODGGUHVV >@8QLYHUVDORUORFDODGGUHVVIODJ8/ )LJXUH'HVWLQDWLRQ$GGUHVV)RUPDW 6SHFLDO)ORZ&RQWURO'HVWLQDWLRQ$GGUHVV 7KHFXUUHQWVSHFLILFDWLRQIRUIXOOGXSOH[IORZFRQWUROVSHFLILHVDVSHFLDOGHVWLQDWLRQDGGUHVVIRUWKH3DXVHRSHUDWLRQ SDFNHW,QRUGHUIRUWKH0$&WRUHFHLYHSDFNHWVZKLFKFRQWDLQWKLVVSHFLDOGHVWLQDWLRQDGGUHVVWKHDGGUHVVPXVWEH SURJUDPPHGLQRQHRIWKH&$0HQWULHV7KLV&$0HQWU\PXVWWKHQEHHQDEOHGDQGWKH&$0DFWLYDWHG 6RPH&$0HQWULHVDUHDOVRXVHGZKHQJHQHUDWLQJDIORZFRQWROSDFNHWXVLQJWKH6G3DXVHELWLQWKH0$&WUDQVPLW FRQWUROUHJLVWHU (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 75$160,77,1*$)5$0( 7RWUDQVPLWDIUDPHWKHWUDQVPLWHQDEOHELWLQWKHWUDQVPLWFRQWUROUHJLVWHUPXVWEHVHWDQGWKHWUDQVPLWKDOWUHTXHVW ELWPXVWEH]HUR,QDGGLWLRQWKHKDOWLPPHGLDWHDQGKDOWUHTXHVWELWVLQWKH0$&FRQWUROUHJLVWHUPXVWEH7KHVH FRQGLWLRQVDUHQRUPDOO\VHWDIWHUDQ\%'0$FRQWUROOHULQLWLDOL]DWLRQKDVRFFXUUHG7KHV\VWHPWKHQXVHVWKH7[BZU DQG7[B(2)VLJQDOVWRWUDQVIHUE\WHVWRWKHWUDQVPLWGDWDEXIIHU 7KHWUDQVPLWVWDWHPDFKLQHVWDUWVWUDQVPLWWLQJWKHGDWDLQWKH),)2DQGZLOOUHWDLQWKHILUVWE\WHVXQWLODIWHUWKLV VWDWLRQKDVDFTXLUHGWKHQHW$WWKDWWLPHWKHWUDQVPLWEORFNUHTXHVWVPRUHGDWDDQGWUDQVPLWVLWXQWLOWKHV\VWHP DVVHUWVWKH7[B(2)LQSXWVLJQDOLQJWKHHQGRIGDWDWREHWUDQVPLWWHG7KHWUDQVPLWEORFNDSSHQGVWKHFDOFXODWHG &5&WRWKHHQGRIWKHSDFNHWDQGWUDQVPLVVLRQHQGV,WWKHQVHWVWKHWUDQVPLWVWDWXVUHJLVWHUELWVLJQDOLQJD VXFFHVVIXOWUDQVPLVVLRQ7KLVDFWLRQPD\FDXVHVDQLQWHUUXSWLIHQDEOHG $IUDPHWUDQVPLWRSHUDWLRQFDQEHVXEGLYLGHGLQWRWZRRSHUDWLRQVD0,,LQWHUIDFHRSHUDWLRQDQGD%'0$ 0$&LQWHUIDFHRSHUDWLRQ %',75$160,723(5$7,21 7KH%',WUDQVPLWRSHUDWLRQLVDVLPSOH),)2PHFKDQLVP7KH%'0$HQJLQHVWRUHVGDWDWREHWUDQVPLWWHGDQGWKH WUDQVPLWVWDWHPDFKLQHHPSWLHVLWZKHQWKH0$&VXFFHVVIXOO\DFTXLUHVWKHQHW 1RWHWKDWWKHWZRWLPHGRPDLQVLQWHUVHFWDWWKH),)2FRQWUROOHU7KHZULWLQJDQGUHDGLQJRIGDWDLVDV\QFKURQRXV DQGRQGLIIHUHQWFORFNV5HDGLQJLVGULYHQE\HLWKHUD0+]RUD0+]WUDQVPLWFORFN:ULWLQJLVGULYHQE\WKH V\QFKURQRXV6\VBFONZKLFKLVDV\QFKURQRXVWR7[BFON $IWHUDUHVHWWKHWUDQVPLW),)2LVHPSW\7KHWUDQVPLWEORFNDVVHUWVWKH7[BUG\VLJQDODQGWUDQVPLVVLRQLV GLVDEOHG7RHQDEOHWUDQVPLVVLRQWKHV\VWHPPXVWVHWWKHWUDQVPLWHQDEOHELWLQWKHWUDQVPLWFRQWUROUHJLVWHU,Q DGGLWLRQHLJKWE\WHVRIGDWDPXVWEHSUHVHQWLQWKHWUDQVPLW),)27KH%'0$HQJLQHFDQVWDUWVWXIILQJGDWDLQWRWKH ),)2DQGWKHQHQDEOHWKHWUDQVPLWELW2ULWFDQHQDEOHWKHWUDQVPLWELWILUVWDQGWKHQVWDUWVWXIILQJGDWDLQWRWKH ),)27KHWUDQVPLWRSHUDWLRQFDQRQO\VWDUWLIERWKRIWKHVHFRQGLWLRQVDUHPHW .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 %',7UDQVPLW7LPLQJ :KHQWKHWUDQVPLWEORFNDVVHUWVWKH7[BUG\VLJQDOWKH%'0$HQJLQHFDQZULWHGDWDLQWRWKHWUDQVPLW),)2E\ DVVHUWLQJWKH7[BZUVLJQDO)LJXUHVKRZVWLPLQJVHTXHQFHVIRUEDFNWREDFNWUDQVIHUVDQGWUDQVIHUVZLWKZDLW VWDWHV7KLVLVDV\QFKURQRXVLQWHUIDFHZKLFKPHDQVWKDWGDWDLVODWFKHGLQDWWKHULVLQJHGJHRIWKH6\VBFONZKHQ 7[BZULVDVVHUWHG)RUVORZHULQWHUIDFHVWKHULVLQJHGJHRI7[BZUFDQEHGHOD\HG 7KLVLVWKHHTXLYDOHQWRIDVVHUWLQJDZDLWVWDWHLQDV\QFKURQRXVRSHUDWLRQ7KHWUDQVPLW),)2PDFKLQHFKHFNVWKH 7[BSDUDQGWKH7[B(2)ELWV,IWKHUHLVDSDULW\HUURUWKHWUDQVPLWEORFNDERUWVWKHWUDQVPLVVLRQUHVHWVWKH),)2 DQGJHQHUDWHVDQLQWHUUXSWE\VHWWLQJWKH7[3DUELWLQWKHWUDQVPLWVWDWXVUHJLVWHU 7KH7[B(2)ELWVLJQDOVWKHHQGRIRQHIUDPHWREHWUDQVPLWWHG:KHQLWGHWHFWVWKLVELWWKHWUDQVPLWEORFNGH DVVHUWV7[BUG\XQWLOLWKDVWUDQVPLWWHGWKHSDFNHW,WWKHQUHDVVHUWV7[BUG\ZKHQWKH%'0$FDQWUDQVIHUWKHQH[W SDFNHWLQWRWKH0$&),)2 5[BZU 5[B'% 5[B%( 5[BSDU 5[B(2) % % % % % % % % % )LJXUH%',7UDQVPLW'DWD7LPLQJ a aa a aa aa aa aa aa a a aa aa 5[BUG\ a a 6\VBFON (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 0,,75$160,723(5$7,21 7KHWUDQVPLWEORFNFRQVLVWVRIWKUHHVWDWHPDFKLQHVWKHJDSBRNVWDWHPDFKLQHWKHEDFNBRIIVWDWHPDFKLQHDQG WKHPDLQWUDQVPLWVWDWHPDFKLQH 7KHJDSBRN6WDWH0DFKLQH 7KHJDSBRNVWDWHPDFKLQHWUDFNVDQGFRXQWVWKHLQWHUJDSWLPLQJEHWZHHQWKHIUDPHV:KHQQRWRSHUDWLQJLQIXOO GXSOH[PRGHLWFRXQWVELWWLPHVIURPWKHGHDVVHUWLRQRIWKHFDUULHUVHQVH&U6VLJQDO,IWKHUHLVDQ\WUDIILF ZLWKLQWKHILUVWELWWLPHVWKHJDSBRNVWDWHPDFKLQHUHVHWLWVHOIDQGVWDUWVFRXQWLQJIURP]HUR ,IWKHUHLVDQ\WUDIILFLQWKHODVWRIWKHLQWHUIUDPHJDSWKHJDSBRNVWDWHPDFKLQHFRQWLQXHVFRXQWLQJ)ROORZLQJ DVXFFHVVIXOWUDQVPLVVLRQDJDSBRNLVVHQWDWWKHHQGRIWKHQH[WELWWLPHVUHJDUGOHVVRIWKHQHWZRUNWUDIILF ,QIXOOGXSOH[PRGHWKHJDSBRNVWDWHPDFKLQHVWDUWVFRXQWLQJDWWKHHQGRIWKHWUDQVPLVVLRQDQGWKHJDSBRNVLJQDO LVVHQWDWWKHHQGRIWKHELWWLPHVUHJDUGOHVVRIWKHQHWZRUNWUDIILF $VVHPEOH0$&IUDPH <HV &DUULHUVHQVH 21" :DLWIRULQWHUIUDPHJDS ELWWLPHVWDUW7[ ZLWKSUHDPEOH6)' <HV &RQWLQXH WUDQVPLVVLRQ &ROOLVLRQGHWHFWHG" 'RQH&RPSOHWH7[ 3UHDPEOHDQG6)' WUDQVPLWWHG" <HV 6WRSWUDQVPLVVLRQ VHQGELWMDP $WWHPSBFRXQW :DLWIRUEDFNRIIWLPH VORWWLPH[U N PLQLPXPQEDFNRIIOLPLW Q0D[BDWWHPSW UDQGRPLQWHJHUU N $WWHPSWBFRXQW! 0D[BDWWHPSW" <HV 5HSRUWDWWHPSWOLPLW H[FHHGHGHUURU 7RXSSHUOHYHOOD\HU )LJXUH&60$&'7UDQVPLW2SHUDWLRQ .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 7KHEDFNBRII6WDWH0DFKLQH 7KHEDFNBRIIVWDWHPDFKLQHLPSOHPHQWVWKHEDFNRIIDQGUHWU\DOJRULWKPRIWKH&60$&':KHQDFROOLVLRQ LVGHWHFWHGWKHPDLQWUDQVPLWVWDWHPDFKLQHVWDUWVWKHEDFNBRIIVWDWHPDFKLQHVFRXQWHUVDQGZDLWVIRUWKHEDFNRII WLPHLQFOXGLQJ]HURWRHODSVH7KLVWLPHLVDPXOWLSOHRIELWWLPHVWKDWHODSVHEHIRUHWKHSDFNHWWKDWFDXVHGWKH FROOLVLRQLVUHWUDQVPLWWHG (DFKWLPHWKHUHLVDFROOLVLRQIRURQHVLQJOHSDFNHWWKHEDFNBRIIVWDWHPDFKLQHLQFUHPHQWVDQLQWHUQDOUHWU\ DWWHPSWFRXQWQHU$ELWSVHXGRUDQGRPQXPEHUJHQHUDWRURXWSXWVDUDQGRPQXPEHUE\VHOHFWLQJDVXEVHWRIWKH YDOXHRIWKHJHQHUDWRUDWDQ\WLPH7KHVXEVHWLVLQFUHPHQWHGE\RQHELWIRUHDFKVXEVHTXHQWDWWHPSW7KLV LPSOHPHQWDWLRQLVUHSUHVHQWHGE\WKHIROORZLQJHTXDWLRQ UDQGRPLQWHJHUU. . PLQQEDFNRIIOLPLW ZKHUHULVWKHQXPEHURIVORWWLPHVWKH0$&PXVWZDLWLQFDVHRIDFROOLVLRQDQGQLVWKHQXPEHURIUHWU\ DWWHPSWV )RUH[DPSOHDIWHUWKHILUVWFROOLVLRQQLVDQGULVDUDQGRPQXPEHUEHWZHHQDQG7KHSVHXGRUDQGRP JHQHUDWRULQWKLVFDVHLVRQHELWZLGHDQGJLYHVDUDQGRPQXPEHURIHLWKHURU$IWHUWKHVHFRQGDWWHPSWULVD UDQGRPQXPEHUEHWZHHQDQG7KHUHIRUHWKHVWDWHPDFKLQHORRNVDWWKHWZROHDVWVLJQLILFDQWELWVRIWKHUDQGRP JHQHUDWRUQ ZKLFKJLYHVDYDOXHEHWZHHQDQG 7KH0DLQ7UDQVPLW6WDWH0DFKLQH 7KHPDLQWUDQVPLWVWDWHPDFKLQHLPSOHPHQWVWKHUHPDLQLQJ0$&OD\HUSURWRFROV,IWKHUHLVGDWDWREHWUDQVIHUUHG LIWKHLQWHUIUDPHJDSLVYDOLGDQGLIWKH0,,LVUHDG\WKDWLVLIWKHUHDUHQRFROOLVLRQVDQGQR&56LQIXOOGXSOH[ PRGHWKHWUDQVPLWEORFNWKHQWUDQVPLWVWKHSUHDPEOHIROORZHGE\WKH6)' $IWHUWKH6)'DQGSUHDPEOHDUHWUDQVPLWWHGWKHEORFNWUDQVPLWVE\WHVRIWKHGDWDUHJDUGOHVVRIWKHSDFNHW OHQJWKXQOHVVVKRUWWUDQVPLVVLRQLVHQDEOHG7KLVPHDQVWKDWLIWKHSDFNHWLVOHVVWKDQE\WHVLWZLOOSDGWKH//& GDWDILHOGZLWK]HURV,WZLOODOVRDSSHQGVWKH&5&WRWKHHQGRIWKHSDFNHWLI&5&JHQHUDWLRQLVHQDEOHG ,IWKHUHLVDQ\FROOLVLRQGXULQJWKLVILUVWE\WHVE\WHVRISUHDPEOHDQG6)'DQGE\WHVRIWKHIUDPHWKHPDLQ WUDQVPLWVWDWHPDFKLQHVWRSVWKHWUDQVPLVVLRQDQGWUDQVPLWVDMDPSDWWHUQELWVRIV,WWKHQLQFUHPHQWVWKH FROOLVLRQDWWHPSWFRXQWHUUHWXUQVFRQWUROWRWKHEDFNBRIIVWDWHPDFKLQHDQGUHWUDQVPLWVWKHSDFNHWZKHQWKH EDFNRIIWLPHKDVHODSVHGDQGWKHJDSWLPHLVYDOLG ,IWKHUHDUHQRFROOLVLRQVWKHWUDQVPLWEORFNWUDQVPLWVWKHUHVWRIWKHSDFNHW$WWKLVWLPHWKDWLVDIWHUWKHILUVW E\WHVKDYHEHHQWUDQVPLWWHGZLWKRXWFROOLVLRQVWKHPDLQWUDQVPLWVWDWHPDFKLQHOHWVWKH%'0$HQJLQHRYHUZULWH WKHSDFNHW$IWHULWWUDQVPLWVWKHILUVWE\WHVWKHWUDQVPLWEORFNWUDQVPLWVWKHUHVWRIWKHSDFNHWDSSHQGLQJWKH &5&WRWKHHQG3DULW\HUURUV),)2HUURUVRUPRUHWKDQFROOLVLRQVZLOOFDXVHWKHWUDQVPLWVWDWHPDFKLQHWRDERUW WKHSDFNHWQRUHWU\DQGTXHXHXSWKHQH[WSDFNHW ,QFDVHRIDQ\WUDQVPLVVLRQHUURUVWKHWUDQVPLWEORFNVHWVWKHDSSURSULDWHHUURUELWLQWKHWUDQVPLWVWDWXVUHJLVWHU,W PD\DOVRJHQHUDWHDQLQWHUUXSWGHSHQGLQJRQWKHHQDEOHELWVHWWLQJVLQWKHWUDQVPLWFRQWUROUHJLVWHU (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7[BHQ 7['>@ &U6 &RO 3 5 ( $ 0 % / ( )LJXUH7LPLQJIRU7UDQVPLWZLWKRXW&ROOLVLRQ 7[BFON 7[BHQ 7['>@ &U6 &RO 3 3 3 3 3 3 3 3 - - - - )LJXUH7LPLQJIRU7UDQVPLWZLWK&ROOLVLRQLQ3UHDPEOH a a a a a a a a a a a a 7[BFON .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 5(&(,9,1*$)5$0( 7KHUHFHLYHEORFNZKHQHQDEOHGFRQVWDQWO\PRQLWRUVDGDWDVWUHDPFRPLQJHLWKHUIURPWKH0,,RULILQORRSEDFN PRGHIURPWKHWUDQVPLWEORFN7KH0,,VXSSOLHVIURP]HURWRVHYHQE\WHVRISUHDPEOHIROORZHGE\WKHVWDUWIUDPH GHOLPLWHU6)'7KHUHFHLYHEORFNFKHFNVWKDWWKHILUVWQLEEOHVUHFHLYHGDUHSUHDPEOHDQGWKHQORRNVIRUWKH6)' LQWKHILUVWHLJKWE\WHV,ILWGRHVQRWGHWHFWWKH6)'E\WKHQLWWUHDWVWKHSDFNHWDVDIUDJPHQWDQG GLVFDUGVLW 7KHILUVWQLEEOHRIGHVWLQDWLRQDGGUHVVIROORZVWKH6)'OHDVWVLJQLILFDQWELWVILUVW:KHQLWKDVUHFHLYHGDE\WHWKH UHFHLYHEORFNJHQHUDWHVSDULW\VWRUHVWKHE\WHZLWKLWVSDULW\LQWKHUHFHLYH),)2DQGDVVHUWV5[BUG\,WFRPELQHV VXEVHTXHQWQLEEOHVLQWRE\WHVDQGVWRUHVWKHPLQWKH),)2 %',5(&(,9('$7$7,0,1* :KHQWKHV\VWHPDVVHUWV5[BUGWKHUHFHLYHEORFNUHDGVWKHILUVWE\WHIURPWKH),)2FKHFNVSDULW\DQGGULYHVWKH E\WHRQ5[B'%DQGWKHE\WHVSDULW\RQ5[BSDU,IWKH),)2LVQRZHPSW\LWGURSV5[BUG\:KHQLWGULYHVRXWWKH ODVWE\WHRIDSDFNHWLWDVVHUWV5[B(2) )LJXUHVKRZVWKHWLPLQJVHTXHQFHIRUWUDQVPLWWLQJE\WHVEDFNWREDFNWUDQVPLWWLQJZLWKZDLWVWDWHVDQG WUDQVPLWWLQJWKHODVWE\WH 5[BUG 5[B'% 5[BSDU 5[B(2) % 3$5 % 3$5 % 3$5 a a aa aa 5[BUG\ a a 6\VBFON a a a a a a %1 3$5 )LJXUH%',5HFHLYH'DWD7LPLQJ a a (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 5(&(,9()5$0(7,0,1*:,7+:,7+287(5525 ,IGXULQJIUDPHUHFHSWLRQERWK5[B'9DQG5[BHUDUHDVVHUWHGD&5&HUURULVUHSRUWHGIRUWKHFXUUHQWSDFNHW $VHDFKQLEEOHRIWKHGHVWLQDWLRQDGGUHVVLVUHFHLYHGWKH&$0EORFNDWWHPSWVWRUHFRJQL]HLW$IWHUUHFHYLQJWKH ODVWGHVWLQDWLRQDGGUHVVQLEEOHLIWKH&$0EORFNUHMHFWVWKHSDFNHWWKHUHFHLYHEORFNDVVHUWVWKH5[BWRVVVLJQDO DQGGLVFDUGVDQ\E\WHVQRW\HWUHPRYHGIURPWKHUHFHLYH),)2WKDWFDPHIURPWKHFXUUHQWSDFNHW,IWKLVRSHUDWLRQ OHDYHVWKH),)2HPSW\LWGURSV5[BUG\ )LJXUHVKRZVWKH0,,UHFHLYHGDWDWLPLQJZLWKRXWHUURU7KH5;B'9VLJQDOZKLFKHQWHUHGWKH0,,IURPWKH 3&6OD\HUZLOOEH21ZKHQWKH3&6OD\HUUHFRYHUVWKH5[BFONIURPWKHUHFHLYHELWVWUHDPDQGGHOLYHUVWKHQLEEOH GDWDRQ5['>@GDWDOLQH7KH5;B'9VLJQDOPXVWEH21EHIRUHWKHVWDUWLQJIUDPHGHOLPLWHU6)'LVUHFHLYHG :KHQWKH5[B'9VLJQDOLV21WKHSUHDPEOHDQG6)'SDUWVRIWKHIUDPHKHDGHUDUHGHOLYHUHGWR0,,V\QFKURQL]HG ZLWKWKH0+]5[BFON7KHFDUULHUVHQVH&U6VLJQDOZDVWXUQHGRQGXULQJUHFHLYHIUDPH $VLWVUHVSRQVHWRWKH5[BHUVLJQDOWKH0,,LPPHGLDWHO\LQVHUWVDQDOWHUQDWLYHGDWDELWVWUHDPLQWRWKHUHFHLYHGDWD VWUHDP$VDUHVXOWWKH0$&GLVFDUGVWKLVUHFHLYHGHUURUIUDPHXVLQJWKH)&6 a a 5[BHU a a &U6 a a 5['>@ a a a a 3UHDPEOH 5[B'9 a a 5[BFON 6)' '$ &5& )LJXUH5HFHLYLQJ)UDPHZLWKRXW(UURU a a 5[BHU a a &U6 a a 5['>@ a a a a 3UHDPEOH 5[B'9 a a 5[BFON 6)' '$ &5& )LJXUH5HFHLYLQJ)UDPHZLWK(UURU .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 &DUULHUVHQVH <HV 21" &DUULHUVHQVH 21 DIWHUGHWHFWLQJ6)' VWRUHE\WHVWUHDPLQ),)2 5HFRJQL]HDGGUHVV" 1R 'LVFDUGWKHIUDPH UHSRUWHUURUVWDWXV 0RYHWKHE\WHVWUHDPLQ WKH),)2WRWKHUHFHLYH EXIIHUPHPRU\ )UDPHWRRVKRUW " )UDPHWRRORQJ" 9DOLG)&6" ,QWHUUXSWWR&38IRU KDQGLQJWKHIUDPH &KHFNHWKHUW\SHRUOHQJWKILHOG 'LVDVVHPEOHIUDPH 6LJQDOWRXSSHUOD\HU 0$&GULYHUVRIWZDUH VRIWZDUHMREVIRUW\SLFDO/$1FDUGV )LJXUH&60$&'5HFHLYH2SHUDWLRQ (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7+(0,,67$7,210$1$*(5 7KH0',2PDQDJHPHQWGDWDLQSXWRXWSXWVLJQDOOLQHLVWKHWUDQVPLWDQGUHFHLYHSDWKIRUFRQWUROVWDWXVLQIRUPDWLRQ IRUWKHVWDWLRQPDQDJHPHQWHQWLW\67$7KH67$FRQWUROVDQGUHDGVWKHFXUUHQWRSHUDWLQJVWDWXVRIWKH3+<OD\HU 7KHVSHHGRIWUDQVPLWDQGUHFHLYHRSHUDWLRQVLVGHWHUPLQHGE\WKHPDQDJHPHQWGDWDFORFN0'& 7KHIUDPHVWUXFWXUHRIWKH67$ZKLFKZULWHVFRPPDQGWRFRQWUROUHJLVWHUVRUZKLFKUHDGVWKHVWDWXVUHJLVWHURID 3+<GHYLFHLVVKRZQ7DEOH7KH3+<DGGUHVVLVGHILQHGDVWKHLGHQWLILFDWLRQ,'YDOXHRIWKHYDULRXV3+< GHYLFHVWKDWPD\EHFRQFHFWHGWRDVLQJOH0$&5HJLVWHUDGGUHVVHVFDQFRQWDLQWKHWKH,'YDOXHIRUXSWRW\SHV RI3+<UHJLVWHUV 7XUQDURXQGELWVDUHXVHGWRUHJXODWHWKHWXUQDURXQGWLPHRIWKHWUDQVPLWUHFHLYHGLUHFWLRQEHWZHHQWKH67$DQGD 3+<GHYLFH6RWKDWWKH67$FDQUHDGWKHVHWYDOXHRID3+<GHYLFHUHJLVWHULWPXVWWUDQVPLWWKHIUDPHGDWDXSWR DVSHFLILFUHJLVWHUDGGUHVVWRWKH3+<GHYLFH'XULQJWKHZULWHWLPHZKLFKLVDQXQGLUHFWHGWUDQVPLVVLRQWKH67$ WUDQVPLWVDVWUHDPRIWXUQDURXQGELWV$VDUHVXOWE\WUDQVPLWWLQJDZULWHRUUHDGPHVVDJHWRD3+<GHYLFH WKURXJKWKH0',2WKH67$FDQLVVXHDUHTXHVWWRVHWWKHRSHUDWLRQRUWRUHDGWKHRSHUDWLRQVWDWXV $VLWVUHVSRQVHWKLVPHVVDJHWKH3+<GHYLFHUHVHWVLWVHOIVHWVORRSEDFNPRGHVHOHFWVDFWLYHQRQDFWLYHDXWR QHJRWLDWLRQSURFHVVVHSDUDWHVWKH3+<DQG0,,HOHFWULFDOO\DQGGHWHUPLQHVZKHWKHURUQRWWRDFWLYDWHWKHFROOLVLRQ GHWHFWLRQSURFHVV :KHQLWUHFHLYHVDUHDGFRPPDQGWKH3+<UHSRUWVWKHNLQGRI3+<GHYLFHLWLVVXFKDV%DVH7)'; EDVH;+';%DVH;0EV)';RU0EV+'; 7DEOH67$)UDPH6WUXFWXUH'HVFULSWLRQ 3UHDPEOH :ULWH &RPPDQG 5HDG6WDWXV ELWV ELWV 6WDUWRI )UDPH 2SHUDWLRQ 3+< &RGH $GGUHVV ZULWH ELWV 5HJLVWHU $GGUHVV ELWV 7XUQ DURXQG ELWV 'DWD ELWV UHJLVWHU YDOXH ELWV UHJLVWHU YDOXH ,GOH = UHDG ELWV ELWV = = 'LUHFWLRQ67$WR3+< 'LUHFWLRQ3+<WR67$ .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 )8//'83/(;3$86(23(5$7,216 7UDQVPLW3DXVH2SHUDWLRQ 7RHQDEOHDIXOOGXSOH[3DXVHRSHUDWLRQWKHVSHFLDOEURDGFDVWDGGUHVVIRU0$&FRQWUROSDFNHWVPXVWEH SURJUDPPHGLQWRWKH&$0DQGWKHFRUUHVSRQGLQJ&$0HQDEOHELWVHW7KHVSHFLDOEURDGFDVWDGGUHVVFDQEHD &$0ORFDWLRQ7RRSWLPL]HWKHXWLOL]DWLRQ&$0HQWULHV\RXFDQVSHFLI\DSUHIHUHQFHIRUVSHFLILF&$0ORFDWLRQV7KLV IHDWXUHLVGHVFULEHGEHORZ 7KH0$&UHFHLYHFLUFXLWUHFRJQL]HVDIXOOGXSOH[3DXVHRSHUDWLRQZKHQWKHIROORZLQJFRQGLWLRQVDUHPHW 7KHW\SHOHQJWKILHOGKDVWKHVSHFLDOYDOXHIRU0$&&RQWUROSDFNHWV[ 7KHSDFNHWLVUHFRJQL]HGE\WKH&$0 7KHOHQJWKRIWKHSDFNHWLVE\WHV 7KHRSHUDWLRQILHOGVSHFLILHVD3DXVHRSHUDWLRQ :KHQDIXOOGXSOH[3DXVHRSHUDWLRQLVUHFRJQL]HGWKH0$&UHFHLYHFLUFXLWORDGVWKHRSHUDQGYDOXHLQWRWKH3DXVH FRXQWUHJLVWHU,WWKHQVLJQDOVERWKWKH0$&DQGWKH%'0$HQJLQHWKDWWKH3DXVHVKRXOGEHJLQDWWKHHQGRIWKH FXUUHQWSDFNHWLIDQ\ 7KH3DXVHFLUFXLWPDLQWDLQVWKH3DXVHFRXQWHUDQGGHFUHPHQWVLWWR]HUR,WGRHVWKLVEHIRUHLWVLJQDOVWKHHQGRI WKH3DXVHRSHUDWLRQDQGEHIRUHDOORZLQJWKHWUDQVPLWFLUFXLWWRUHVXPHLWVRSHUDWLRQ ,IDVHFRQGIXOOGXSOH[3DXVHRSHUDWLRQLVUHFRJQL]HGZKLOHWKHILUVWRSHUDWLRQLVLQHIIHFWWKH3DXVHFRXQWHULVUHVHW ZLWKWKHFXUUHQWRSHUDQGYDOXH1RWHWKDWDFRXQWYDOXHRI]HURPD\FDXVHSUHPDWXUHWHUPLQDWLRQRID3DXVH RSHUDWLRQWKDWLVDOUHDG\LQSURJUHVV 5HPRWH3DXVH2SHUDWLRQ 7RVHQGDUHPRWH3DXVHRSHUDWLRQIROORZLQJWKHVHVWHSV 3URJUDP&$0ORFDWLRQZLWKWKHGHVWLQDWLRQDGGUHVV 3URJUDP&$0ORFDWLRQZLWKWKHVRXUFHDGGUHVV 3URJUDP&$0ORFDWLRQZLWKOHQJWKW\SHILHOGRSFRGHDQGRSHUDQG 3URJUDPWKHE\WHVWKDWIROORZWKHRSHUDQGZLWK+ 3URJUDPWKHWKUHHGRXEOHZRUGVWKDWIROORZ&$0ORFDWLRQZLWK]HURV :ULWHWKHWUDQVPLWFRQWUROUHJLVWHUWRVHWWKH6G3DXVHELW 7KHGHVWLQDWLRQDGGUHVVDQGVRXUFHDGGUHVVDUHFRPPRQO\XVHGDVWKHVSHFLDOEURDGFDVWDGGUHVVIRU0$&FRQWURO IUDPHVDQGWKHORFDOVWDWLRQDGGUHVVUHVSHFWLYHO\7RVXSSRUWIXWXUHXVHVRI0$&FRQWUROIUDPHVWKHVHYDOXHVDUH IXOO\SURJUDPPDEOHLQWKHIORZFRQWURO0ELWV(WKHUQHW0$& :KHQWKHUHPRWH3DXVHRSHUDWLRQLVFRPSOHWLRQWKHWUDQVPLWVWDWXVLVZULWWHQWRWKHWUDQVPLWFRQWUROIUDPHVWDWXV UHJLVWHU7KH%'0$HQJLQHLVUHVSRQVLEOHIRUSURYLGLQJDQLQWHUUXSWHQDEOHFRQWURO (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 (UURU6LJQDOLQJ 7KHHUURUDEQRUPDORSHUDWLRQIODJVDVVHUWHGE\WKH0$&DUHDUUDQJHGLQWRWUDQVPLWDQGUHFHLYHJURXSV7KHVHIODJ JURXSVDUHORFDWHGHLWKHULQWKHWUDQVPLWVWDWXVUHJLVWHU7[BVWDWRUWKHUHFHLYHVWDWXVUHJLVWHU5[BVWDW$PLVVHG SDFNHWHUURUFRXQWHULVLQFOXGHGIRUV\VWHPQHWZRUNPDQDJHPHQWSXUSRVHV 1RUPDOO\VRIWZDUHGRHVQRWKDYHHQRXJKGLUHFWFRQWUROWRH[DPLQHWKHVWDWXVUHJLVWHUVGLUHFWO\7KHUHIRUHWKH %'0$HQJLQHPXVWVWRUHWKHYDOXHVLQV\VWHPPHPRU\VRWKDWWKH\FDQEHH[DPLQHGWKHUHE\VRIWZDUH 5HSRUWLQJRI7UDQVPLVVLRQ(UURUV $WUDQVPLWRSHUDWLRQWHUPLQDWHVZKHQWKHHQWLUHSDFNHWSUHDPEOH6)'GDWDDQG&5&KDVEHHQVXFFHVVIXOO\ WUDQVPLWWHGWKURXJKWKH0,,ZLWKRXWDFROOLVLRQ,QDGGLWLRQWKHWUDQVPLWEORFNGHWHFWVDQGUHSRUWVERWKLQWHUQDODQG QHWZRUNHUURUV 8QGHUWKHIROORZLQJFRQGLWLRQVWKHWUDQVPLWRSHUDWLRQZLOOEHDERUWHGLQPRVWFDVHV 3DULW\HUURU 7KHELWVRIGDWDFRPLQJLQWKURXJKWKH%',,KDVDQRSWLRQDOSDULW\ELW$SDULW\ELW DOVRSURWHFWVHDFKE\WHLQWKH0$&WUDQVPLW),)2,IDSDULW\HUURURFFXUVLWLV UHSRUWHGWRWKHWUDQVPLWVWDWHPDFKLQHDQGWKHWUDQVPLVVLRQLVDERUWHG$GHWHFWHG SDULW\HUURUVHWVWKH7[3DUELWLQWKHWUDQVPLWVWDWXVUHJLVWHU 7KHE\WHWUDQVPLW),)2FDQKDQGOHDV\VWHPODWHQF\RITMELWWLPHV$Q XQGHUUXQRIWKHWUDQVPLW),)2GXULQJWUDQVPLVVLRQLQGLFDWHVDV\VWHPSUREOHP QDPHO\WKDWWKHV\VWHPFDQQRWNHHSXSZLWKWKHGHPDQGVRIWKH0$&DQGWKH WUDQVPLVVLRQLVDERUWHG 7KHFDUULHUVHQVHVLJQDO&U6LVPRQLWRUHGIURPWKHEHJLQLQJRIWKHVWDUWRIIUDPH GHOLPLWHU6)'WRWKHODVWE\WHWUDQVPLWWHG$1R&U6LQGLFDWHVWKDW&U6ZDVQHYHU SUHVHQWGXULQJWUDQVPLVVLRQDSRVVLEOHQHWZRUNSUREOHPEXWWKHWUDQVPLVVLRQZLOO 127EHDERUWHG1RWHWKDWGXULQJORRSEDFNPRGHWKH0$&LVGLVFRQQHFWHGIURPWKH QHWZRUNDQGD1R&5&ZLOOQRWEHGHWHFWHG :KHQHYHUWKH0$&HQFRXQWHUVDFROOLVLRQGXULQJWUDQVPLWLWZLOOEDFNRIIXSGDWHWKH DWWHPSWFRXQWHUDQGUHWU\WKHWUDQVPLVVLRQODWHURQ:KHQWKHDWWHPSWFRXQWHU UHDFKHVDWWHPSWVWKDWDOOUHVXOWHGLQDFROOLVLRQWKHWUDQVPLVVLRQLVDERUWHG 7KLVLQGLFDWHVDQHWZRUNSUREOHP 7UDQVPLWRXWRIZLQGRZFROOLVLRQ 1RUPDOO\WKH0$&ZRXOGGHWHFWDFROOLVLRQLIRQHRFFXUVZLWKLQWKHILUVWE\WHVRI GDWDWKDWDUHWUDQVPLWWHGLQFOXGLQJWKHSUHDPEOHDQG6)',IDFROOLVLRQRFFXUVDIWHU WKLVWLPHIUDPHDSRVVLEOHQHWZRUNSUREOHPLVLQGLFDWHG7KHHUURULVUHSRUWHGWRWKH WUDQVPLWVWDWHPDFKLQHEXWWKHWUDQVPLVVLRQLV127DERUWHG,QVWHDGLWSHUIRUPVD EDFNRIIDVXVXDO 'XULQJLWVILUVWDWWHPSWWRVHQGDSDFNHWWKH0$&PD\KDYHWRGHIHUWKHWUDQVPLVVLRQ EHFDXVHWKHQHWZRUNLVEXV\,IWKLVGHIHUUDOWLPHLVORQJHUWKDQ.ELWWLPHVWKH WUDQVPLVVLRQLVDERUWHG([FHVVLYHGHIHUUDOHUURUVLQGLFDWHDSRVVLEOHQHWZRUN SUREOHP 7UDQVPLW),)2XQGHUUXQ 1R&56 ([FHVVLYHFROOLVLRQHUURU /DWHFROOLVLRQHUURU ([FHVVLYHGHIHUUDOHUURU .6&5,6&0,&52&21752//(5 (7+(51(7&21752//(5 5HSRUWLQJRI5HFHLYH(UURUV :KHQLWGHWHFWVDVWDUWRIIUDPHGHOLPLWHU6)'WKHUHFHLYHVWDWHPDFKLQHVWDUWVSXWWLQJGDWDLWKDVUHFHLYHGIURP WKH0,,LQWRWKHUHFHLYH),)2,WDOVRFKHFNVIRULQWHUQDOHUURUV),)2RYHUUXQVZKLOHUHFHSWLRQLVLQSURJUHVV :KHQWKHUHFHLYHRSHUDWLRQLVFRPSOHWHGWKHUHFHLYHVWDWHPDFKLQHFKHFNVIRUH[WHUQDOHUURUVVXFKDVIUDPH DOLJQPHQWOHQJWK&5&DQGIUDPHWRRORQJ 7KHIROORZLQJLVDGHVFULSWLRQRIWKHW\SHVRIHUURUVWKDWPD\RFFXUGXULQJDUHFHLYHRSHUDWLRQ 3ULRULW\HUURU $SDULW\ELWSURWHFWVHDFKE\WHLQWKH0$&UHFHLYH),)2,IDSDULW\HUURURFFXUVLWLV UHSRUWHGWRWKHUHFHLYHVWDWHPDFKLQH$GHWHFWHGSDULW\HUURUVHWVWKH5[3DUELWLQWKH UHFHLYHVWDWXVUHJLVWHU 'ULEEOH $IWHUUHFHLYLQJDSDFNHWWKHUHFHLYHEORFNFKHFNVWKDWWKHLQFRPLQJSDFNHWLQFOXGLQJ &5&ZDVFRUUHFWO\IUDPHGRQDQELWERXQGDU\,ILWLVQRWDQGLIWKH&5&LVLQYDOLG GDWDKDVEHHQGLVUXSWHGWKURXJKWKHQHWZRUNDQGWKHUHFHLYHEORFNUHSRUWVDIUDPH DOLJQPHQWHUURU$&5&HUURULVDOVRUHSRUWHG $IWHUUHFHLYLQJDSDFNHWWKHUHFHLYHEORFNFKHFNVWKH&5&IRUYDOLGLW\DQGUHSRUWVD &5&HUURULILWLVLQYDOLG7KHUHFHLYHXQLWFDQGHWHFWQHWZRUNUHODWHGHUURUVVXFKDV &5&IUDPHDOLJQPHQWDQGOHQJWKHUURUV,WFDQDOVRGHWHFWWKHVHW\SHVRIHUURUVLQWKH IROORZLQJFRPELQDWLRQV &5&HUURUVRQO\ )UDPHDOLJQPHQWDQG&5&HUURUVRQO\ /HQJWKDQG&5&HUURUVRQO\ )UDPHDOLJQPHQWOHQJWKDQG&5&HUURUV )UDPHWRRORQJ 7KHUHFHLYHEORFNFKHFNVWKHOHQJWKRIWKHLQFRPLQJSDFNHWDWWKHHQGRIUHFHSWLRQ LQFOXGLQJ&5&EXWH[FOXGLQJSUHDPEOHDQG6)',IWKHOHQJWKLVORQJHUWKDQWKH PD[LPXPIUDPHVL]HRIE\WHVWKHUHFHLYHEORFNUHSRUWVUHFHLYLQJDORQJSDFNHW XQOHVVORQJIUDPHPRGHLVHQDEOHG 'XULQJUHFHSWLRQWKHLQFRPLQJGDWDDUHSXWLQWRWKHUHFHLYH),)2WHPSRUDULO\EHIRUH WKH\DUHWUDQVIHUUHGWRWKHV\VWHPPHPRU\,IWKH),)2LVILOOHGXSEHFDXVHRIH[FHVVLYH V\VWHPODWHQF\RUIRURWKHUUHDVRQVWKHUHFHLYHEORFNVHWVWKHRYHUUXQELWLQWKHUHFHLYH VWDWXVUHJLVWHU 7KH3+<LQIRUPVWKH0$&LILWGHWHFWVDPHGLXPHUURUVXFKDVDFRGLQJYLRODWLRQE\ DVVHUWLQJWKHLQSXWSLQ5[BHU:KHQWKH0$&VHHV5[BHUDVVHUWHGLWVHWV&5&(UUELWRI WKHUHFHLYHVWDWXVUHJLVWHU )UDPH$OLJQPHQW(UURU &5&(UURU 5HFHLYH),)2RYHUUXQ 0,,HUURU (7+(51(7&21752//(5 .6&5,6&0,&52&21752//(5 7LPLQJ3DUDPHWHUVIRU0,,7UDQVDFWLRQV 7KHWLPLQJGLDJUDPVLQWKLVVHFWLRQFRQIRUPWRWKHJXLGHOLQHVGHVFULEHGLQWKH'UDIW6XSSOHPHQWWR$16,,(((6WG 6HFWLRQ6LJQDO&KDUDFWHULVWLFV 7[BFON QV0,1QV0$; 7['>@ 7[BHQ )LJXUH7UDQVPLW6LJQDO7LPLQJ5HODWLRQVKLSDW0,, 5[BFON QV0,1 QV0,1 5['>@ 5[B'9 5[BHU ,13879$/,' )LJXUH5HFHLYH6LJQDO7LPLQJ5HODWLRQVKLSDW0,, &\FOHV &\FOHV 0'& QV0,1QV0$; 0',2 )LJXUH0',26RXUFHGE\3+< 0'& QV0,1 QV0,1 0',2 ,13879$/,' )LJXUH0',26RXUFHGE\67$ .6&5,6&0,&52&21752//(5 +'/&&21752//(56 +'/&&21752//(56 7KH.6&KDVWZRKLJKOHYHOGDWDOLQNFRQWUROOHUV+'/&VWRVXSSRUWWZRFKDQQHOVHULDOFRPPXQLFDWLRQV 7KH+'/&PRGXOHVXSSRUWVD&38GDWDOLQNLQWHUIDFHWKDWFRQIRUPVWRWKHV\QFKURQRXVGDWDOLQNFRQWURO6'/& DQGKLJKOHYHOGDWDOLQNFRQWURO+'/&VWDQGDUGV,QDGGLWLRQWKHIROORZLQJIXQFWLRQEORFNVDUHLQWHJUDWHGLQWRWKH +'/&PRGXOH 7ZRFKDQQHO'0$HQJLQHIRU7[5[ 6XSSRUWEXIIHUGHVFULSWRUVSHUIUDPH 'LJLWDOSKDVHORFNHGORRS'3//EORFN %DXGUDWHJHQHUDWRU%5* +'/&&21752//(56 .6&5,6&0,&52&21752//(5 )($785(6 ,PSRUWDQWIHDWXUHVRIWKH.6&+'/&EORFNDUHDVIROORZV 3URWRFROIHDWXUHV )ODJGHWHFWLRQDQGV\QFKURQL]DWLRQ =HURLQVHUWLRQDQGGHOHWLRQ ,GOHGHWHFWLRQDQGWUDQVPLVVLRQ )&6HQFRGLQJDQGGHWHFWLRQELW $ERUWGHWHFWLRQDQGWUDQVPLVVLRQ )RXUDGGUHVVVWDWLRQUHJLVWHUVDQGRQHPDVNUHJLVWHUIRUDGGUHVVVHDUFKPRGH 6HOHFWDEOH&5&1R&5&PRGH $XWRPDWLF&5&JHQHUDWRUSUHVHW 'LJLWDO3//EORFNIRUFORFNUHFRYHU\ %DXGUDWHJHQHUDWRU 15=15=,)00DQFKHVWHUGDWDIRUPDWVIRU7[5[ /RRSEDFNDQGDXWRHFKRPRGH 7[DQG5[),)2VZLWKZRUG;ELWGHSWK 6HOHFWDEOHZRUGRUZRUGGDWDWUDQVIHUPRGHIRU7[5[ 'DWDDOLJQPHQWORJLF (QGLDQWUDQVODWLRQ 3URJUDPPDEOHLQWHUUXSWV 0RGHPLQWHUIDFH +DUGZDUHIORZFRQWURO %XIIHUGHVFULSWRUIRU7[5[ 7ZRFKDQQHO'0$&RQWUROOHU 7ZRFKDQQHOVIRU+7[),)2DQG+5;),)2 6LQJOHRUZRUG;ELWEXUVWWUDQVIHUPRGH 0D[LPXPIUDPHVL]HDOORZVIRUXSWR.E\WHV 8SWR0ESVIXOOGXSOH[RSHUDWLRQXVLQJDQH[WHUQDOLQWHUQDOFORFN +'/&IUDPHOHQJWKEDVHGRQRFWHWV .6&5,6&0,&52&21752//(5 +'/&&21752//(56 )81&7,21'(6&5,37,216 )LJXUHVKRZVWKH+'/&PRGXOHVIXQFWLRQEORFNV7KHVHIXQFWLRQEORFNVDUHGHVFULEHGLQGHWDLOLQWKHIROORZLQJ VHFWLRQV 7[),)2 :RUGV $GGUHVV '0$ &RQWUROOHU )ODJ$ERUW,GOH *HQHUDWRUDQG 7UDQVPLWWHU )&6*HQHUDWRU DXWRHFKR =HUR ,QVHUWLRQ (QFRGHU 7[' 5 ( 0 2 7 ( 6 ( 5 , $ / 5[' 7[& 3 2 5 7 6 < 6 7 ( 0 % 8 6 +'/&&RQWURODQG 6WDWXV5HJLVWHUV :RUG )&6&KHFNHU &RQWURO 'DWD $GGUHVV %XV$UELWHU &RQWUROOHU )ODJ$ERUW,GOH 'HWHFWLRQ =HUR 'HOHWLRQ 'HFRGHU ORRS 5HFHLYH6KLIW 5HJLVWHU GSOORXW5 GSOORXW7 5[),)2 :RUGV '3// EUJRXW 5[& EUJRXW %5* 0&/. 0+] )LJXUH+'/&0RGXOH%ORFN'LDJUDP +'/&&21752//(56 .6&5,6&0,&52&21752//(5 +'/&)5$0()250$7 7KH+'/&WUDQVPLWVDQGUHFHLYHVGDWDDGGUHVVFRQWUROLQIRUPDWLRQDQG&5&ILHOGLQDVWDQGDUGIRUPDWFDOOHGD IUDPH$OOIUDPHVVWDUWZLWKDQRSHQLQJIODJEHJLQQLQJRIIODJ%2)(+DQGHQGZLWKDFORVLQJIODJHQGRIIODJ (2)(+%HWZHHQWKHRSHQLQJDQGWKHFORVLQJIODJVDIUDPHFRQWDLQVDQDGGUHVV$ILHOGDFRQWURO&ILHOGDQ LQIRUPDWLRQ,ILHOGRSWLRQDODQGDIUDPHFKHFNVHTXHQFH)&6ILHOGVHH7DEOH 7DEOH+'/&'DWD)UDPH)RUPDW 2SHQLQJ )ODJ $GGUHVV )LHOG ELWVSHUE\WH &RQWURO )LHOG ELWVSHUE\WH ,QIRUPDWLRQ )LHOG ELWVSHUE\WH YDULDEOHOHQJWK )UDPH&KHFN 6HTXHQFH)LHOG ELWV &ORVLQJ )ODJ 127( 7KHDGGUHVVILHOGFDQEHH[WHQGHGXSWRIRXUE\WHVXVLQJDRSWLRQDOVRIWZDUHFRQWUROVHWWLQJ )ODJ) $IODJLVDXQLTXHELQDU\SDWWHUQWKDWLVXVHGWRGHOLPLW+'/&IUDPHV7KLVSDWWHUQLVJHQHUDWHGLQWHUQDOO\ E\WKHWUDQVPLWWHU$QRSHQLQJIODJVWDUWVDIUDPHDQGDFORVLQJIODJHQGVWKHIUDPH2SHQLQJIODJVDQGFORVLQJIODJV DUHDXWRPDWLFDOO\DSSHQGHGWRIUDPHV $VLQJOHIODJSDWWHUQFDQRSWLRQDOO\VHUYHDVERWKWKHFORVLQJIODJRIRQHIUDPHDQGWKHRSHQLQJIODJRIWKHQH[WRQH 7KLVIHDWXUHLVFRQWUROOHGE\WKHGRXEOHIODJ))VLQJOHIODJ)RUIUDPHVHSDUDWRUVHOHFWLRQELWWKH7[6')/ELWLQ WKH+&21UHJLVWHU 2UGHURI%LW7UDQVPLVVLRQ $GGUHVVILHOGFRQWUROILHOGDQGLQIRUPDWLRQILHOGE\WHVDUHWUDQVIHUUHGEHWZHHQWKH&38DQGWKH+'/&PRGXOHLQ SDUDOOHORYHUWKHGDWDEXV7KHVHE\WHVDUHWUDQVPLWWHGDQGUHFHLYHG/6%ILUVW7KHELWIUDPHFKHFNVHTXHQFH )&6ILHOGLVKRZHYHUWUDQVPLWWHGDQGUHFHLYHG06%ILUVW .6&5,6&0,&52&21752//(5 +'/&&21752//(56 $GGUHVV$)LHOG 7KHHLJKWELWVWKDWIROORZWKHRSHQLQJIODJDUHFDOOHGDGGUHVV$ILHOG7KHDGGUHVVILHOGDUHH[SHQGDEOH7RH[WHQG WKLVDGGUHVVE\WHVLPSO\XVHUGHILQHGDGGUHVVZULWHWRWKHVWDWLRQDGGUHVVUHJLVWHU7RFKHFNDGGUHVVE\WHDJDLQVW WKHLQFRPLQJGDWDKDYHWREHXVHGWKH0$6.UHJLVWHU,IPDWFKRFFXUUHGWKHIUDPHVGDWDLQFOXGLQJDGGUHVVDQG &5&ELWLQWRWKH+5;),)2DQGWKHQPRYHGWRV\VWHPPHPRU\,ILWLVQRWPDWFKHGVLPSO\GLVFDUGHG .6&DOORZVXSWRELWVDGGUHVV)RULQVWDQFH6'/&DQG/$3%XVHDQELWDGGUHVV/$3'IXUWKHU GLYLGHVLWVELWDGGUHVVLQWRGLIIHUHQWILHOGVWRVSHFLI\YDULRXVDFFHVVSRLQWVRQHSLHFHRIHTXLSPHQW6RPH+'/& W\SHSURWRFRODOORZVIRUH[WHQGHGDGGUHVVLQJEH\RQGELW &RQWURO&)LHOG 7KHHLJKWELWVWKDWIROORZWKHDGGUHVVILHOGDUHFDOOHGWKHFRQWUROOLQNFRQWURO&ILHOG7KH.6&+'/& PRGXOHWUHDWVWKHFRQWUROILHOGLQWKHVDPHZD\DVWKHLQIRUPDWLRQILHOG7KDWLVLWSDVVHVWKHHLJKWELWVWRWKH&38 RUPHPRU\GXULQJUHFHSWLRQ7KH&38LVUHVSRQVLEOHIRUKRZWKHFRQWUROILHOGLVKDQGOHGDQGZKDWKDSSHQVWRLW ,QIRUPDWLRQ,)LHOG 7KHLQIRUPDWLRQ,ILHOGIROORZVWKHFRQWURO&ILHOGDQGSUHFHGHVWKHIUDPHFKHFNVHTXHQFH)&6ILHOG7KH LQIRUPDWLRQILHOGFRQWDLQVWKHGDWDWREHWUDQVIHUUHG1RWHYHU\IUDPHKRZHYHUPXVWDFWXDOO\FRQWDLQLQIRUPDWLRQ GDWD7KHZRUGOHQJWKRIWKH,ILHOGLVHLJKWELWVLQWKH.6&+'/&PRGXOH$QG,WVWRWDOOHQJWKFDQEH H[WHQGHGE\ELWVXQWLOWHUPLQDWHGE\WKH)&6ILHOGDQGWKHFORVLQJIODJ )UDPH&KHFN6HTXHQFH)&6)LHOG 7KHELWVWKDWSUHFHGHWKHFORVLQJIODJFRPSULVHWKHIUDPHFKHFNVHTXHQFH)&6ILHOG7KH)&6ILHOGFRQWDLQV WKHF\FOLFUHGXQGDQF\FKHFNFKDUDFWHU&5&&7KHSRO\QRPLDO[[[LVXVHGERWKIRUWKHWUDQVPLWWHU DQGWKHUHFHLYHU%RWKWKHWUDQVPLWWHUDQGWKHUHFHLYHUSRO\QRPLDOUHJLVWHUVDUHDOOLQLWLDOL]HGWRSULRUWRFDOFXODWLQJ RIWKH)&67KHWUDQVPLWWHUFDOFXODWHVWKHIUDPHFKHFNVHTXHQFHRIDOODGGUHVVELWVFRQWUROELWVDQGLQIRUPDWLRQ ILHOGV,WWKHQWUDQVPLWVWKHFRPSOHPHQWRIWKHUHVXOWLQJUHPDLQGHUDVWKH)&6YDOXH 7KHUHFHLYHUSHUIRUPVDVLPLODUFDOFXODWLRQIRUDOODGGUHVVFRQWURODQGLQIRUPDWLRQELWVDVZHOODVIRUDOOWKH)&6 ILHOGVUHFHLYHG,WWKHQFRPSDUHVWKHUHVXOWWR)%+:KHQDPDWFKRFFXUVWKHIUDPHYDOLG5[)9VWDWXVELWLVVHW WR:KHQWKHUHVXOWGRHVQRWPDWFKWKHUHFHLYHUVHWVWKH&5&HUURUELW5[&5&(WR7KHWUDQVPLWWHUDQGWKH UHFHLYHUDXWRPDWLFDOO\SHUIRUPWKHVH)&6JHQHUDWLRQWUDQVPLVVLRQDQGFKHFNLQJIXQFWLRQV7KH.6& +'/&PRGXOHDOVRVXSSRUWV12&5&RSHUDWLRQPRGH,Q12&5&PRGHWUDQVPLWWHUGRHVQRWDSSHQG)&6WRWKH HQGRIGDWDDQGWKHUHFHLYHUDOVRGRHVQRWFKHFN)&6,QWKLVPRGHWKHGDWDSUHFHGLQJWKHFORVLQJIODJLV WUDQVIHUUHGWRWKH+5;),)2,Q&5&PRGHWKH)&6ILHOGLVWUDQVIHUUHGWRWKH+5;),)2 +'/&&21752//(56 .6&5,6&0,&52&21752//(5 35272&2/)($785(6 ,19$/,')5$0( $YDOLGIUDPHPXVWKDYHDWOHDVWWKH$&DQG)&6ILHOGVEHWZHHQLWVRSHQLQJDQGFORVLQJIODJV(YHQLIQR&5& PRGHLVVHWWKHIUDPHVL]HVKRXOGQRWEHOHVVWKDQELWV7KHUHDUHWKUHHLQYDOLGIUDPHFRQGLWLRQV 6KRUWIUDPHDIUDPHWKDWFRQWDLQVOHVVWKDQELWVEHWZHHQIODJV6KRUWIUDPHVDUHLJQRUHG ,QYDOLGIUDPHDIUDPHZLWKELWVRUPRUHKDYLQJD&5&FRPSDUHHUURURUQRQE\WHDOLJQHG,QYDOLGIUDPHV DUHWUDQVIHUUHGWRWKH+5;),)2WKHQWKHLQYDOLGIUDPHHUURUIODJ5[&5&(5[12LQWKHVWDWXVUHJLVWHULVVHW WRLQGLFDWHWKDWDQLQYDOLGIUDPHKDVEHHQUHFHLYHG $ERUWHGIUDPHDIUDPHDERUWHGE\WKHUHFHSWLRQRIDQDERUWVHTXHQFHLVKDQGOHGDVDQLQYDOLGIUDPH =(52,16(57,21$1'=(52'(/(7,21 7KH]HURLQVHUWLRQDQG]HURGHOHWLRQIHDWXUHZKLFKDOORZVWKHFRQWHQWRIDIUDPHWREHWUDQVSDUHQWLVKDQGOHG DXWRPDWLFDOO\E\WKH+'/&PRGXOH:KLOHWKHWUDQVPLWWHULQVHUWVDELQDU\IROORZLQJDQ\VHTXHQFHRIILYHV ZLWKLQDIUDPHWKHUHFHLYHUGHOHWHVDELQDU\WKDWIROORZVDVHTXHQFHRIILYHVZLWKLQDIUDPH $%257 7KHIXQFWLRQRIHDUO\WHUPLQDWLRQRIDGDWDOLQNLVFDOOHGDQDERUW7KHWUDQVPLWWHUDERUWVDIUDPHE\VHQGLQJDWOHDVW HLJKWFRQVHFXWLYHVLPPHGLDWHO\DIWHUWKHDERUWWUDQVPLWWHUFRQWUROELW7[$%7LQ+&21LVVHWWR6HWWLQJWKLV FRQWUROELWDXWRPDWLFDOO\FOHDUVWKH+7[),)2 7KHDERUWVHTXHQFHFDQEHH[WHQGHGXSWRDWOHDVWFRQVHFXWLYHVE\VHWWLQJWKHDERUWH[WHQGFRQWUROELW 7[$%7(;7LQ+&21WR7KLVIHDWXUHLVXVHIXOIRUIRUFLQJWKHPDUNLGOHVWDWH7KHUHFHLYHULQWHUSUHWVWKH UHFHSWLRQRIVHYHQRUPRUHFRQVHFXWLYHVDVDQDERUW 7KHUHFHLYHUUHVSRQGVWKHDERUWUHFHLYHGDVIROORZV $QDERUWLQDQRXWRIIUDPHFRQGLWLRQDQDERUWKDVQRPHDQLQJGXULQJWKHLGOHRUWKHWLPHILOO $QDERUWLQIUDPHDIWHUOHVVWKDQELWVDUHUHFHLYHGDIWHUDQRSHQLQJIODJXQGHUWKLVFRQGLWLRQQRILHOGRIWKH DERUWHGIUDPHLVWUDQVIHUUHGWRWKH+5;),)27KH+'/&PRGXOHFOHDUVWKHDERUWHGIUDPHGDWDLQWKHUHFHLYHU DQGIODJV\QFKURQL]DWLRQ7KHDERUWHGUHFHSWLRQLVLQGLFDWHGLQWKHVWDWXVUHJLVWHU $QDERUWLQIUDPHDIWHUELWVRUPRUHDUHUHFHLYHGDIWHUDQRSHQLQJIODJLQWKLVFRQGLWLRQVRPHILHOGVRIWKH DERUWHGIUDPHPD\EHWUDQVIHUUHGWRWKH+5;),)27KHDERUWVWDWXVLVVHWLQWKHVWDWXVUHJLVWHUDQGWKHGDWDRI WKHDERUWHGIUDPHLQWKH+5;),)2LVFOHDUHG)ODJV\QFKURQL]DWLRQLVDOVRFOHDUHGDQGWKH'0$RSHUDWLRQIRU UHFHLYHLQJLVDERUWHGWRR ,'/($1'7,0(),// :KHQWKHWUDQVPLWWHULVQRWWUDQVPLWWLQJDIUDPHLWLVLQDQLGOHVWDWH7KHWUDQVPLWWHUVLJQDOVWKDWLWKDVHQWHUHGDQ LGOHVWDWHLQRQHRIWKHIROORZLQJWZRZD\VE\WUDQVPLWWLQJDFRQWLQXRXVVHULHVRIIODJSDWWHUQVWLPHILOORUE\ WUDQVPLWWLQJDVWUHDPRIFRQVHFXWLYHVPDUNLGOH7KHIODJVDQGPDUNLGOHDUHQRWWUDQVIHUUHGWRWKH+5;),)2 7KHIODJRUPDUNLGOHVHOHFWLRQELW7[)/$*LQ+&21FRQWUROVWKLVIXQFWLRQZKHQ7[)/$*LVPDUNLGOHLV VHOHFWHGZKHQ7[)/$*,'/(LVWKHWLPHILOOPHWKRGLVVHOHFWHG .6&5,6&0,&52&21752//(5 +'/&&21752//(56 ),)26758&785( ,QERWKWUDQVPLWDQGUHFHLYHGLUHFWLRQVE\WHZRUGGHHS),)2VDUHSURYLGHGIRUWKHLQWHUPHGLDWHVWRUDJHRI GDWDEHWZHHQWKHVHULDOLQWHUIDFHDQGWKH&38LQWHUIDFH 7:2&+$11(/'0$(1*,1( 7KH+'/&PRGXOHKDVDWZRFKDQQHO'0$HQJLQHIRU7[5[),)2V7KH'0$7;FKDQQHOSURJUDPPLQJDQGWKH 5;FKDQQHOSURJUDPPLQJDUHGHVFULEHGLQWKHWUDQVPLWWHUDQGUHFHLYHURSHUDWLRQVHFWLRQVUHVSHFWLYHO\ %$8'5$7(*(1(5$725 7KH+'/&PRGXOHFRQWDLQVDSURJUDPPDEOHEDXGUDWHJHQHUDWRU%5*7KH%5*UHJLVWHUFRQWDLQVDELWWLPH FRQVWDQWUHJLVWHUDELWGRZQFRXQWHUIRUWLPHFRQVWDQWYDOXHWZRFRQWUROELWWRGLYLGHDQGDQRWKHUWZRFRQWURO ELWVWRGLYLGHRU $FORFNGLDJUDPRIWKH%5*LVVKRZQLQ)LJXUH $WDVWDUWXSWKHIOLSIORSRQWKHRXWSXWLVVHWLQD+LJKVWDWHWKHYDOXHLQWKHWLPHFRQVWDQWUHJLVWHULVORDGHGLQWR WKHFRXQWHUDQGWKHFRXQWHUVWDUWVFRXQWLQJGRZQ7KHRXWSXWRIWKHEDXGUDWHJHQHUDWRUPD\WRJJOHXSRQ UHDFKLQJ]HURWKHYDOXHLQWKHWLPHFRQVWDQWUHJLVWHULVORDGHGLQWRWKHFRXQWHUDQGWKHSURFHVVLVUHSHDWHG7KH WLPHFRQVWDQWPD\EHFKDQJHGDQ\WLPHEXWWKHQHZYDOXHGRHVQRWWDNHHIIHFWXQWLOWKHQH[WORDGRIWKHFRXQWHU 7KHRXWSXWRIWKHEDXGUDWHJHQHUDWRUPD\EHXVHGDVHLWKHUWKHWUDQVPLWFORFNWKHUHFHLYHFORFNRUERWK,WFDQ DOVRGULYHWKHGLJLWDOSKDVHORFNHGORRS,IWKHUHFHLYHRUWUDQVPLWFORFNLVQRWSURJUDPPHGWRFRPHIURPWKH7;& SLQWKHRXWSXWRIWKHEDXGUDWHJHQHUDWRUPD\EHHFKRHGRXWYLDWKH7;&SLQ 7KHIROORZLQJIRUPXODUHODWHVWKHWLPHFRQVWDQWWRWKHEDXGUDWHZKHUH0&/.RU5;&LVWKHEDXGUDWHJHQHUDWRU LQSXWIUHTXHQF\LQ+]%5*JHQHUDWHVRXWSXWVLJQDOV%5*287%5*287IRUWUDQVPLWUHFHLYHFORFNVDQGWKH '3//LQSXWFORFN %5*287 0&/.RU5;&&17&17 %5*287 %5*287RURUDFFRUGLQJWR&17YDOXHRIWKH+%5*7& &17 5[& 0&/. %LW&RXQWHU &17 &17 'LYLGHE\ RU 'LYLGHE\ RURU %5*287 %5*287 %5*&/. &17+%5*7&>@ &17+%5*7&>@ &17+%5*7&>@ %5*&/.+02'(>@ )LJXUH%DXG5DWH*HQHUDWRU%ORFN'LDJUDP +'/&&21752//(56 .6&5,6&0,&52&21752//(5 7KHH[DPSOHLQWKHIROORZLQJ7DEOHDVVXPHVD0+]FORFNIURP0&/.D0+]FORFNIURP5[&VKRZLQJD WLPHFRQVWDQWIRUDQXPEHURIFRPPRPO\XVHGEDXGUDWHV 7DEOH%DXG5DWH([DPSOHRI+'/& %DXG5DWH %5*287 0&/. 0+] &17 &17 &17 )UHT 'HY &17 5;& 0+] &17 &17 )UHT 'HY .6&5,6&0,&52&21752//(5 +'/&&21752//(56 ',*,7$/3+$6(/2&.('/223'3// 7KH+'/&PRGXOHFRQWDLQVDGLJLWDOSKDVHORFNHGORRS'3//IXQFWLRQWRUHFRYHUFORFNLQIRUPDWLRQIURPDGDWD VWUHDPZLWK15=,RU)0HQFRGLQJ7KH'3//LVGULYHQE\DFORFNWKDWLVQRUPDOO\15=,RU)0WLPHVWKH GDWDUDWH7KH'3//XVHVWKLVFORFNDORQJZLWKWKHGDWDVWUHDPWRFRQVWUXFWWKHFORFN 7KLVFORFNPD\WKHQEHXVHGDVWKHUHFHLYHFORFNWKHWUDQVPLWFORFNRUERWK )LJXUHVKRZVDEORFNGLDJUDPRIWKHGLJLWDOSKDVHORFNHGORRS,WFRQVLVWVRIDELWFRXQWHUDQHGJHGHWHFWRU DQGDSDLURIRXWSXWGHFRGHUV 5[' (GJH 'HWHFWRU &RXQW0RGLILHU 'HFRGHU 5HFHLYH&ORFN GSOORXW5 7[& 5[& 0&/. %UJRXW %UJRXW +02'(>@ %LW&RXQWHU 'HFRGHU 7UDQVPLW&ORFN GSOORXW7 )LJXUH'3//%ORFN'LDJUDP &/2&.86$*(0(7+2' %5*&/. %5*287 7[& 5[& 0&/. %5*287 %5*287 '3//&/. '3//2877 '3// '3//2875 5[& 0&/. %DXG5DWH *HQHUDWRU %5*287 7[&/. 7[& 5[& '3//2877 %5*287 %5*287 7[& 5[& '3//2875 %5*287 %5*287 5[&/. 7UDQVPLW 7UDQVPLW 7UDQVPLWWHU &ORFN 'DWD 5HFHLYH &ORFN 5HFHLYHU 5HFHLYH 'DWD 127( %5*&/. +02'(>@ '3//&/. +02'(>@ 7[&/. +02'(>@ 5[&/. +02'(>@ )LJXUH&ORFN8VDJH0HWKRG'LDJUDP +'/&&21752//(56 .6&5,6&0,&52&21752//(5 ,QWKH15=15=,PRGHWKH'3//VRXUFHFORFNPXVWEHWLPHVWKHGDWDUDWHV,QWKLVPRGHWKHWUDQVPLWDQG UHFHLYHFORFNRXWSXWVRIWKH'3//DUHLGHQWLFDODQGWKHFORFNVDUHSKDVHGVRWKDWWKHUHFHLYHUVDPSOHVWKHGDWDLQ WKHPLGGOHRIWKHELWFHOO 7KH'3//FRXQWVWKH[FORFNXVLQJDQLQWHUQDOELWFRXQWHU$VWKH[FORFNLVFRXQWHGWKH'3//VHDUFKHVWKH LQFRPLQJGDWDVWUHDPIRUHGJHVHLWKHUSRVLWLYHRUQHJDWLYHWUDQVLWLRQ7KHRXWSXWRI'3//LV+LJKZKLOHWKH'3// LVZDLWLQJIRUDQHGJHLQWKHLQFRPLQJGDWDVWUHDP:KHQLWGHWHFWVDWUDQVLWLRQWKH'3//VWDUWVWKHFORFNUHFRYHU\ RSHUDWLRQ 7KHILUVWVDPSOLQJHGJHRIWKH'3//RFFXUVDWWKHFRXQWHUYDOXHRIDIWHUWKHILUVWHGJHLVGHWHFWHGLQWKH LQFRPLQJGDWDVWUHDP7KHVHFRQGVDPSOLQJHGJHRFFXUVIROORZLQJWKHQH[W:KHQWKHWUDQVLWLRQRILQFRPLQJ GDWDRFFXUVDWDFRXQWYDOXHRWKHUWKDQWKH'3//DGMXVWVLWVFORFNRXWSXWVGXULQJWKHQH[WWRFRXQWLQJ F\FOHE\H[WHQGLQJRUVKRUWHQLQJLWVFRXQWE\RQHZKLFKHIIHFWLYHO\PRYHVWKHHGJHRIWKHFORFNVDPSOLQJWKH UHFHLYHGDWDFORVHUWRWKHFHQWHURIWKHELWFHOO 7KHDGGLQJRUVXEWUDFWLQJRIDFRXQWRIZLOOSURGXFHDSKDVHMLWWHURIGHJUHHVRQWKHRXWSXW%HFDXVHWKH '3//XVHVERWKHGJHVRIWKHLQFRPLQJVLJQDOIRULWVFORFNVRXUFHFRPSDULVRQWKHPDUNVSDFHUDWLRRIWKH LQFRPLQJVLJQDOPXVWQRWGHYLDWHPRUHWKDQRILWVEDXGUDWHLISURSHUORFNLQJLVWRRFFXU ,QWKH)0PRGHWKH'3//FORFNPXVWEHWLPHVWKHGDWDUDWH7KHELWFRXQWHULQWKH'3//FRXQWVIURPWR VRWKH'3//PDNHVWZRVDPSOLQJFORFNVGXULQJWKHWRFRXQWLQJF\FOH7KH'3//RXWSXWLV/RZZKLOHWKH'3// LVZDLWLQJIRUDQHGJHLQWKHLQFRPLQJGDWDVWUHDP7KHILUVWHGJHWKH'3//GHWHFWVLVDVVXPHGWREHDYDOLGFORFN HGJH)URPWKLVSRLQWWKH'3//EHJLQVWRJHQHUDWHRXWSXWFORFNV ,QWKLVPRGHWKHWUDQVPLWFORFNRXWSXWRIWKH'3//ODJVWKHUHFHLYHFORFNRXWSXWVE\GHJUHHVWRPDNHWKH WUDQVPLWDQGUHFHLYHELWFHOOERXQGDULHVWKHVDPHEHFDXVHWKHUHFHLYHUPXVWVDPSOHWKH)0GDWDDWDRQHTXDUWHU DQGWKUHHTXDUWHUVELWWLPH <RXFDQSURJUDPWKH;FORFNIRUWKH'3//WRRULJLQDWHIURPRQHRIWKH5;&LQSXWSLQVIURPWKH7[&SLQRUIURP WKHEDXGUDWHJHQHUDWRURXWSXW<RXFDQDOVRSURJUDPWKH'3//RXWSXWWREHHFKRHGRXWRIWKH+'/&PRGXOH RYHUWKH7;&SLQLIWKH7;&SLQLVQRWEHLQJXVHGDVDQLQSXW 'XULQJLGOHWLPH\RXFDQVHWWKH7[350%LQ+&21WRVHQGWKHVSHFLDOSDWWHUQUHTXLUHGIRUDUHPRWH'3//WRORFN WKHSKDVH,QWKLVFDVHWKHFRQWHQWRIWKH+350%UHJLVWHULVVHQWUHSHDWHGO\7KHOHQJWKRISUHDPEOHLVGHWHUPLQHG E\7[3/ELWLQ+02'(>@ ,WLVQRWLFHGWKDWWKHIUHTXHQF\RIWKHUHFHLYHFORFN5[&VKRXOGEHVORZHUWKDQKDOIRIWKHLQWHUQDOV\VWHPFORFN LH0&/.2WKHUZLVHWKHGDWDWUDQVIHUIURPUHFHLYH),)2WRPHPRU\FRXOGEHORVW .6&5,6&0,&52&21752//(5 +'/&&21752//(56 +'/&23(5$7,21$/'(6&5,37,21 7KHIROORZLQJVHFWLRQVGHVFULEHWKHRSHUDWLRQRIWKH+'/&PRGXOH +'/&,1,7,$/,=$7,21 $SRZHURQRUUHVHWRSHUDWLRQLQLWLDOL]HVWKH+'/&PRGXOHDQGIRUFHVLWLQWRWKHUHVHWVWDWH$IWHUDUHVHWWKH&38 PXVWZULWHDPLQLPXPVHWRIUHJLVWHUVDVZHOODVDQ\RSWLRQVVHWEDVHGRQWKHIHDWXUHVDQGRSHUDWLQJPRGHV UHTXLUHG )LUVWWKHFRQILJXUDWLRQRIWKHVHULDOSRUWDQGWKHFORFNPRGHPXVWEHGHILQHG7KHVHVHWWLQJVLQFOXGHWKHIROORZLQJ 'DWDIRUPDWVHOHFW %5*FORFNVHOHFW '3//FORFNVHOHFW 7UDQVPLWFORFNVHOHFW 5HFHLYHFORFNVHOHFW %5*'3//HQDEOHWRXVHLQWHUQDOFORFN <RXPXVWDOVRVHWWKHFORFNIRUYDULRXVFRPSRQHQWVEHIRUHHDFKFRPSRQHQWLVHQDEOHG$GGLWLRQDOUHJLVWHUVPD\ DOVRKDYHWREHSURJUDPPHGGHSHQGLQJRQWKHIHDWXUHV\RXVHOHFW$OOVHWWLQJVIRUWKH+'/&PRGHUHJLVWHU +02'(DQGWKH+'/&FRQWUROUHJLVWHU+&21PXVWEHSURJUDPPHGEHIRUHWKH+'/&LVHQDEOHG 7RHQDEOHWKH+'/&PRGXOH\RXPXVWZULWHDWRWKHUHFHLYHUHQDEOHELWDQGRUWKHWUDQVPLWWHUHQDEOHELW'XULQJ QRUPDORSHUDWLRQ\RXFDQGLVDEOHWKHUHFHLYHURUWKHWUDQVPLWWHUE\ZULWLQJDWRWKH5[(1RU7[(1ELW UHVSHFWLYHO\<RXFDQGLVDEOHWKHUHFHLYHUDQG+5;),)2RUWKHWUDQVPLWWHUDQG+7[),)2E\ZULWLQJDWRWKH 5[56RU7[56ELWUHVSHFWLYHO\ +'/&&21752//(56 .6&5,6&0,&52&21752//(5 +'/&'$7$(1&2',1*'(&2',1* 'DWDHQFRGLQJLVXWLOL]HGWRDOORZWKHWUDQVPLVVLRQRIFORFNDQGGDWDLQIRUPDWLRQRYHUWKHVDPHPHGLXP7KLVVDYHV WKHQHHGWRWUDQVPLWFORFNVDQGGDWDRYHUDVHSDUDWHPHGLXPDVZRXOGQRUPDOO\EHUHTXLUHGIRUV\QFKURQRXVGDWD 7KH+'/&SURYLGHVIRXUGLIIHUHQWGDWDHQFRGLQJPHWKRGVVHOHFWHGE\ELWVLQ+&21>@$QH[DPSOHRIWKHVH IRXUHQFRGLQJPHWKRGVLVVKRZQLQILJXUH 'DWD 15= %LW&HOO/HYHO +LJK /RZ 1R&KDQJH &KDQJH %LW&HQWHU7UDQVLWLRQ 7UDQVLWLRQ 1R7UDQVLWLRQ 1R7UDQVLWLRQ 7UDQVLWLRQ +LJK/RZ /RZ+LJK 15=, )0 %LSKDVH0DUN )0 %LSKDVH6SDFH 0DQFKHVWHU 15=15=,7\SH 7[&ORFN 'DWD 5[&ORFN )0)00DQFKHVWHU7\SH 7[&ORFN 'DWD 5[&ORFN )LJXUH'DWD(QFRGLQJ0HWKRGVDQG7LPLQJ'LDJUDPV .6&5,6&0,&52&21752//(5 +'/&&21752//(56 +'/&75$160,77(523(5$7,21 7KH+7[),)2UHJLVWHUFDQQRWEHSUHORDGHGZKHQWKHWUDQVPLWWHULVGLVDEOHG$IWHUWKH+'/&7[LVHQDEOHGWKH IODJRUPDUNLGOHFRQWUROELW7[)/$*LQ+&21LVXVHGWRVHOHFWHLWKHUWKHPDUNLGOHVWDWHLQDFWLYHLGOHRUWKHIODJ WLPHILOODFWLYHLGOHVWDWH7KLVDFWLYHRULQDFWLYHLGOHVWDWHZLOOFRQWLQXHXQWLOGDWDLVORDGHGLQWRWKH+7[),)2 7KHFRQWHQWRIWKH+350%UHJLVWHUFDQEHVHQWRXWE\VHWWLQJWKH7[350%LQ+&21IRUWKHUHPRWH'3//EHIRUH WKHGDWDLVORDGHGLQWRWKH+7[),)27KHOHQJWKRISUHDPEOHWREHWUDQVPLWWHGLVGHWHUPLQHGE\7[3/ELWVLQ +02'( 7KHDYDLODELOLW\RIGDWDLQWKH+7[),)2LVLQGLFDWHGE\WKH+7[),)2DYDLODEOHELW7[)$LQ+67$7XQGHUWKHFRQWURO RIWKHZRUGWUDQVIHUPRGHELW7[:'LQ+&21 :KHQ\RXVHOHFWZRUGWUDQVIHUPRGHQRWZRUGVHOHFWPRGHRQHZRUGFDQEHORDGHGLQWRWKH+7[),)2 DVVXPLQJWKH7[)$ELWLVVHWWR:KHQ\RXVHOHFWZRUGWUDQVIHUPRGHIRXUVXFFHVVLYHZRUGVFDQEH WUDQVIHUUHGWRWKH),)2LIWKH7[)$ELWLVVHWWR 7KHQ&76FOHDUWRVHQGLQSXWQ576UHTXHVWWRVHQGDQGQ'&'GDWDFDUULHUGHWHFWDUHSURYLGHGIRUDPRGHP RURWKHUKDUGZDUHSHULSKHUDOLQWHUIDFH ,QDXWRHQDEOHPRGHQ'&'EHFRPHVWKHUHFHLYHUHQDEOH+RZHYHUWKHUHFHLYHUHQDEOHELWPXVWEHVHWEHIRUHWKH Q'&'SLQLVXVHGLQWKLVPDQQHU 7KH7[)&VWDWXVELWLQ+67$7FDQFDXVHDQLQWHUUXSWWREHJHQHUDWHGXSRQIUDPHFRPSOHWLRQ7KLVELWLVVHWZKHQ WKHUHLVQRGDWDLQ+7[),)2DQGZKHQWKHFORVLQJIODJRUDQDERUWLVWUDQVPLWWHG +'/&&21752//(56 .6&5,6&0,&52&21752//(5 7UDQVPLWWHU,QWHUUXSW0RGH 7KHILUVWE\WHRIDIUDPHWKHDGGUHVVILHOGVKRXOGEHZULWWHQLQWRWKH7[),)2DWWKHIUDPHFRQWLQXHDGGUHVV 7KHQWKHWUDQVPLVVLRQRIWKHIUDPHGDWDVWDUWVDXWRPDWLFDOO\7KHE\WHVRIWKHIUDPHFRQWLQXHWREHZULWWHQLQWRWKH 7[),)2DVORQJDVGDWDLVZULWWHQWRWKHIUDPHFRQWLQXHDGGUHVV7KH+'/&ORJLFNHHSVWUDFNRIWKHILHOG VHTXHQFHZLWKLQWKHIUDPH 7KHIUDPHLVWHUPLQDWHGZKHQWKHODVWIUDPHGDWDLVZULWWHQWRWKH7[),)2VIUDPHWHUPLQDWHDGGUHVV7KH)&6 ILHOGLVDXWRPDWLFDOO\DSSHQGHGE\KDUGZDUHDORQJZLWKDFORVLQJIODJ'DWDIRUDQHZIUDPHFDQEHORDGHGLQWRWKH 7[),)2LPPHGLDWHO\DIWHUWKHSUHYLRXVIUDPHGDWDLI7[)$LV7KHFORVLQJIODJFDQVHUYHDVWKHRSHQLQJIODJRI WKHQH[WIUDPHRUVHSDUDWHRSHQLQJDQGFORVLQJIODJVFDQEHWUDQVPLWWHG,IDQHZIUDPHLVQRWUHDG\WREH WUDQVPLWWHGDIODJWLPHILOORUPDUNLGOHSDWWHUQLVWUDQVPLWWHGDXWRPDWLFDOO\ ,IWKH7[),)2EHFRPHVHPSW\DWDQ\WLPHGXULQJWKHIUDPHWUDQVPLVVLRQDQXQGHUUXQRFFXUVDQGWKHWUDQVPLWWHU DXWRPDWLFDOO\WHUPLQDWHVWKHIUDPHE\WUDQVPLWWLQJDQDERUW7KHXQGHUUXQVWDWHLVLQGLFDWHGZKHQWKHWUDQVPLWWHU XQGHUUXQVWDWXVELW7[8LV :KHQHYHU\RXVHWWKHWUDQVPLVVLRQDERUWFRQWUROELW7[$%7LQ+&21WKHWUDQVPLWWHULPPHGLDWHO\DERUWVWKH IUDPHWUDQVPLWVDWOHDVWHLJKWFRQVHFXWLYHVFOHDULQJWKH7[),)2,IWKHWUDQVPLVVLRQDERUWH[WHQVLRQFRQWUROELW 7[$%7(;7LVVHWDWWKHWLPHDQLGOHSDWWHUQDWOHDVWFRQVHFXWLYHVLVWUDQVPLWWHG$QDERUWRULGOHLQDQRXW RIIUDPHFRQGLWLRQFDQEHXVHIXOWRJDLQRUELWVRIGHOD\WLPHEHWZHHQUHDGDQGZULWHRSHUDWLRQV 7UDQVPLWWHU'0$0RGH 7RXVH'0$RSHUDWLRQZLWKRXW&38LQWHUYHQWLRQ\RXKDYHWRPDNH7[EXIIHUGHVFULSWRUFKDLQLQDGYDQFH$QGVHW WKH'0$7[EXIIHUGHVFULSWRUSRLQWHU'0$7[375UHJLVWHUWRWKHDGGUHVVRIWKHILUVWEXIIHUGHVFULSWRURIWKHFKDLQ DQGWKHQ'0$7[FKDQQHOVKRXOHEHHQDEOHG :KHQ7[XQGHUUXQRU&76ORVWFRQGLWLRQRFFXUVGXULQJ'0$RSHUDWLRQ'0$7[HQDEOHELW+&21>@LVFOHDUHG DQG'0$7[RSHUDWLRQLVVWRSSHG7KLVVLWXDWLRQLVUHSRUWHGWRV\VWHPZLWK'7[$%7ELWVHW+67$7>@ ,QFDVHRI7[XQGHUUXQDERUWVLJQDOVHQGHGDQGWKHQLGOHSDWWHUQLVVHQGHGLI7[(1ELWLVVHW,QFDVHRI&76ORVW 7['RXWSXWJRHVKLJKVWDWHDVORQJDV&76UHPDLQVKLJKOHYHO .6&5,6&0,&52&21752//(5 +'/&&21752//(56 +'/&5(&(,9(523(5$7,21 7KH+'/&UHFHLYHULVSURYLGHGZLWKGDWDDQGDSUHV\QFKURQL]HGFORFNE\PHDQVRIWKH5;'DQGWKHLQWHUQDO'3// FORFNWKH7;&SLQRUWKH5;&SLQ7KHGDWDLVDFRQWLQXRXVVWUHDPRIELQDU\ELWV2QHRIWKHFKDUDFWHULVWLFVRIWKLV ELWVWUHDPLVWKDWDPD[LPXPRIILYHFRQVHFXWLYHVFDQRFFXUXQOHVVDQDERUWIODJRULGOHFRQGLWLRQRFFXUV7KH UHFHLYHUFRQWLQXRXVO\VHDUFKHVELWE\ELWIRUIODJVDQGDERUWV :KHQDIODJLVGHWHFWHGWKHUHFHLYHUV\QFKURQL]HVWKHIUDPHWRWKHIODJWLPLQJ,IDVHULHVRIIODJVLVUHFHLYHGWKH UHFHLYHUUHV\QFKURQL]HVWKHIUDPHWRHDFKVXFFHVVLYHIODJ ,IWKHIUDPHLVWHUPLQDWHGEHFDXVHRIDVKRUWIUDPHFRQGLWLRQIUDPHGDWDLVOHVVWKDQELWVDIWHUDQRSHQLQJIODJ WKHIUDPHLVVLPSO\LJQRUHG1RLVHRQWKHGDWDLQSXWOLQH5;'GXULQJWLPHILOOFDQFDXVHWKLVNLQGRILQYDOLGIUDPH 7KHUHFHLYHGGDWDZKLFKLVFORFNHGE\WKHH[WHUQDO7;&RU5;&RUE\DQLQWHUQDO'3//RU%5*VRXUFHHQWHUVD ELWRUELWVKLIWUHJLVWHUEHIRUHLWLVWUDQVIHUUHGLQWRWKH+5;),)26\QFKURQL]DWLRQLVHVWDEOLVKHGZKHQDIODJLV GHWHFWHGLQWKHILUVWHLJKWORFDWLRQVRIWKHVKLIWUHJLVWHU:KHQV\QFKURQL]DWLRQKDVEHHQDFKLHYHGGDWDLVFORFNHG WKURXJKWRWKHODVWE\WHORFDWLRQRIWKHVKLIWUHJLVWHUZKHUHLWLVWUDQVIHUUHGLQWRWKH+5;),)2 ,QZRUGWUDQVIHUPRGHZKHQWKH+5;),)2DYDLODEOHELW5[)$LVGDWDLVDYDLODEOHDWOHDVWLQRQHZRUG,Q ZRUGWUDQVIHUPRGHWKH5[)$LVZKHQGDWDLVDYDLODEOHLQWKHODVWIRXU),)2UHJLVWHUORFDWLRQVUHJLVWHUV DQG7KHQ'&'LQSXWLVSURYLGHGIRUDPRGHPRURWKHUKDUGZDUHLQWHUIDFH,I$XWR(1ELWLQ+&21>@LVVHWWR WKHUHFHLYHURSHUDWLRQLVGHSHQGHQWRQWKHQ'&'LQSXWOHYHO 2WKHUZLVHUHFHLYHURSHUDWLRQLVIUHHRIWKHQ'&'LQSXWOHYHO 5HFHLYHU,QWHUUXSW0RGH :KHQHYHUGDWDLVDYDLODEOHLQWKH+5;),)2DQLQWHUUXSWLVJHQHUDWHGE\5[)$LIWKHLQWHUUXSWLVHQDEOHG7KH &38UHDGVWKH+'/&VWDWXVUHJLVWHUHLWKHULQUHVSRQVHWRWKHLQWHUUXSWUHTXHVWRULQWXUQGXULQJDSROOLQJVHTXHQFH :KHQWKHUHFHLYHGGDWDDYDLODEOHELW5[)$LVWKH&38FDQUHDGWKHGDWDIURPWKH+5;),)2,IWKH&38UHDGV QRUPDOGDWDRUDGGUHVVGDWDIURPWKH+5;),)2WKH5[)$ELWLVDXWRPDWLFDOO\FOHDUHG ,Q&5&PRGHWKHELWVSUHFHGLQJWKHFORVLQJIODJDUHUHJDUGHGDVWKH)&6DQGFKHFNHGE\KDUGZDUHDQGWKH\ DUHWUDQVIHUUHGWRWKH+5;),)2$OVRLQQR&5&PRGHZLWKRXWWKHKDUGZDUHFKHFNLQJDOOGDWDELWVSUHFHGLQJWKH FORVLQJIODJDUHWUDQVIHUUHGWRWKH+5;),)2:KHQWKHFORVLQJIODJLVVHQWWRWKHUHFHLYHUWKHIUDPHLVWHUPLQDWHG :KDWHYHUGDWDLVSUHVHQWLQWKHPRVWVLJQLILFDQWE\WHRIWKHUHFHLYHUWKHVKLIWUHJLVWHULVULJKWMXVWLILHGDQG WUDQVIHUUHGWRWKH+5;),)27KHIUDPHERXQGDU\SRLQWHUZKLFKLVH[SODLQHGLQWKH+5;),)2UHJLVWHUVHFWLRQLV VHWVLPXOWDQHRXVO\LQWKH+5;),)2:KHQWKHODVWE\WHRIWKHIUDPHDSSHDUVDWWKHZRUGRUZRUGERXQGDU\ ORFDWLRQRIWKH+5;),)2GHSHQGLQJRQWKHVHWWLQJVRIWKH5[:'FRQWUROELWWKHIUDPHERXQGDU\SRLQWHUVHWVWKH IUDPHYDOLGVWDWXVELWLIWKHIUDPHLVFRPSOHWHGZLWKQRHUURURUWKH5[&5&(VWDWXVELWLIWKHIUDPHZDVFRPSOHWHG EXWZLWKD&5&HUURU ,IWKHIUDPHUHFHSWLRQLVFRPSOHWHGDQ5[&5&(LQWHUUXSWIRUDIUDPHHUURURUDQ5[)9LQWHUUXSWIRUQRUPDOVWDWH LVJHQHUDWHG$WWKLVSRLQWWKH&38FDQUHDGWKH5[UHPDLQLQJE\WHV5[5%VWDWXVELWVWRNQRZKRZPDQ\E\WHVRI WKLVIUDPHVWLOOUHPDLQLQWKH+5;),)2 :KHQ\RXVHWWKHIUDPHGLVFRQWLQXHFRQWUROELWWKHLQFRPLQJIUDPHGLVFDUGFRQWUROELWWRWKHUHFHLYHUGLVFDUGV WKHFXUUHQWIUDPHGDWDZLWKRXWGURSSLQJWKHIODJV\QFKURQL]DWLRQ<RXFDQXVHWKLVIHDWXUHWRLJQRUHDIUDPHZLWKD QRQPDWFKHGDGGUHVV +'/&&21752//(56 .6&5,6&0,&52&21752//(5 5HFHLYHU'0$0RGH 7RXVH'0$RSHUDWLRQZLWKRXW&38LQWHUYHQWLRQ\RXKDYHWRPDNH5[EXIIHUGHVFULSWRUFKDLQLQDGYDQFH$QGVHW WKH'0$5[EXIIHUGHVFULSWRUSRLQWHU'0$5[375UHJLVWHUWRWKHDGGUHVVRIWKHILUVWEXIIHUGHVFULSWRURIWKHFKDLQ DQGWKHQ'0$5[FKDQQHOVKRXOGEHHQDEOHG +$5':$5()/2:&21752/ 7[&ORFN 7[' ODVW 576 &76 )LJXUHQ&76DOUHDG\$VVHUWHG :KHQQ&76LVDFWLYHDQGWKHUHH[LVWVGDWDWREHWUDQVPLWWHGLQ7[),)2Q576HQWHUV/RZDOORZLQJGDWD WUDQVPLVVLRQ$WWKHEHJLQQLQJRIWKHGDWDLVDQRSHQIODJZKLOHDWWKHHQGDFORVLQJIODJ,IWKHIUDPHEHLQJ WUDQIHUUHGGLVFRQWLQXHVQ576JRHVEDFNWRWKH+LJKDIWHUWKHGDWDWUDQVPLVVLRQLVFRPSOHWHG 7[&ORFN 7[' 'DWD F\FOHV 576 &76 F\FOHV )LJXUH&76/RVWGXULQJ7UDQVPLVVLRQ :KHQWKHFRQGLWLRQRIQ&76LVVKLIWHGIURP/RZWR+LJK,WLVGHWHFWHGDWWKHIDOOLQJHGJHRI7[FORFNZKHUHQ576 DOVRJRHV+LJK)RUDERXWWRF\FOHVDIWHUQ576HQWHUV+LJKWKHGDWDWUDQVPLVVLRQFRQWLQXHVQ576UHPDLQV +LJKIRUDPD[LPXPRIF\FOHVDQGJRHVEDFNWRWKH/RZFRQGLWLRQLIWKHUHUHPDLQVDQ\GDWDWREHWUDQVPLWWHGLQ +7[),)2,IQ&76LVVWLOO+LJKHYHQZKHQQ576ZHQWEDFNWR/RZQRWWKHGDWDLQ+7[),)2EXWDPDUNLGOHSDWWHUQ LVWUDQVPLWWHG .6&5,6&0,&52&21752//(5 +'/&&21752//(56 7[&ORFN 7[' 576 &76 F\FOHV 'DWD )LJXUH&76'HOD\HGRQ ,IQ&76UHPDLQVVWLOO+LJKIRUDZKLOHDIWHUQ576HQWHUV/RZWRDOORZGDWDWUDQVPLVVLRQIURP+7[),)2WKHGDWD WUDQVPLVVLRQVWDUWVF\FOHVDIWHUQ&76LVVKLIWHGWR/RZ +'/&&21752//(56 .6&5,6&0,&52&21752//(5 0(025<'$7$6758&785( 7KHIORZFRQWUROWRWKH+'/&FRQWUROOHUXVHVWZRGDWDVWUXFWXUHVWRH[FKDQJHFRQWUROLQIRUPDWLRQDQGGDWD 7UDQVPLWEXIIHUGHVFULSWRU 5HFHLYHEXIIHUGHVFULSWRU (DFK7['0$EXIIHUGHVFULSWRUKDVWKHIROORZLQJHOHPHQWV %XIIHUGDWDSRLQWHU 2ZQHUVKLSELW &RQWUROILHOGIRUWUDQVPLWWHU 6WDWXVILHOGIRU7[ 7UDQVPLWEXIIHUOHQJWK 1H[WEXIIHUGHVFULSWRUSRLQWHU (DFK5['0$EXIIHUGHVFULSWRUKDVWKHIROORZLQJHOHPHQWV %XIIHUGDWDSRLQWHU 2ZQHUVKLSELW 6WDWXVILHOGIRU5[ $FFXPXODWHGUHFHLYHGEXIIHUOHQJWKIRUDIUDPH 1H[WEXIIHUGHVFULSWRUSRLQWHU .6&5,6&0,&52&21752//(5 +'/&&21752//(56 '$7$%8))(5'(6&5,3725 7KHRZQHUVKLSELWLQWKH06%RIWKHEXIIHUGDWDSRLQWHUFRQWUROVWKHRZQHUVKLSRIWKHGHVFULSWRU:KHQWKH RZQHUVKLSELWLVWKH'0$FRQWUROOHURZQVWKHGHVFULSWRU:KHQWKLVELWLVWKH&38KDVWKHGHVFULSWRU7KH RZQHURIWKHGHVFULSWRUDOZD\VRZQVWKHDVVRFLDWHGGDWDIUDPH7KHGHVFULSWRUVEXIIHUGDWDSRLQWHUILHOGDOZD\V SRLQWVWRWKLVEXIIHUIRUDERXWDIUDPH $VLWUHFHLYHVWKHGDWDWKHVRIWZDUHVHWVWKHPD[LPXPIUDPHOHQJWKUHJLVWHU,IWKHUHFHLYHGGDWDLVORQJHUWKDQWKH YDOXHRIWKHPD[LPXPIUDPHOHQJWKUHJLVWHUWKLVIUDPHLVLJQRUHGDQGWKH)/9ELWLVVHW7KHVRIWZDUHDOVRVHWVWKH '0$5[EXIIHUGHVFULSWRUSRLQWHUWRSRLQWWRDFKDLQRIEXIIHUGHVFULSWRUVDOORIZKLFKKDYHWKHLURZQHUVKLSELW 7KH'0$FRQWUROOHUFDQEHVWDUWHGWRVHWWKH'0$5[HQDEOHELWLQWKHFRQWUROUHJLVWHU:KHQDIUDPHLVUHFHLYHGLW LVPRYHGLQWRPHPRU\DWWKHDGGUHVVVSHFLILHGE\WKH'0$5[GDWDEXIIHUSRLQWHU,IDIUDPHLVORQJHUWKDQWKH YDOXHRIWKH5[%XI6L]HUHJLVWHUWKHQWKHQH[WEXIIHUGHVFULSWRUVDUHIHWFKHGWRUHFHLYHWKHIUDPH 7KDWLVWRKDQGOHDIUDPHRQHRUPRUHEXIIHUGHVFULSWRUVFRXOGEHXVHG3OHDVHQRWHWKDWQRFRQILJXUDEOHRIIVHWRU SDJHERXQGDU\FDOFXODWLRQLVUHTXLUHG7KHUHFHLYHGIUDPHLVPRYHGWRWKHEXIIHUPHPRU\ZKRVHDGGUHVVLV SRLQWHGWRE\WKHEXIIHUGDWDSRLQWHUXQWLOWKHHQGRIIUDPHRUXQWLOWKHOHQJWKH[FHHGVWKHPD[LPXPIUDPHOHQJWK FRQILJXUHG,IWKHOHQJWKH[FHHGVWKHPD[LPXPIUDPHOHQJWKFRQILJXUHGWKHIUDPHOHQJWKYLRODWHGELWLVVHW ,IWKHHQWLUHIUDPHLVUHFHLYHGVXFHVVIXOO\WKHVWDWXVELWVLQWKHUHFHLYHEXIIHUGHVFULSWRUDUHVHWWRLQGLFDWHWKH UHFHLYHGIUDPHVWDWXV7KHRZQHUVKLSELWLQWKHEXIIHUGHVFULSWRUSRLQWHULVFOHDUHGE\WKH&38ZKLFKKDVWKH RZQHUVKLSDQGDQLQWHUUXSWPD\QRZEHJHQHUDWHG7KH'0$FRQWUROOHUFRSLHVWKHQH[WEXIIHUGHVFULSWRUSRLQWHU LQWRWKH'0$5[EXIIHUGHVFULSWRUSRLQWHUUHJLVWHU ,IWKHQH[WEXIIHUGHVFULSWRUSRLQWHULVQXOOWKH'5[(1ELWLVFOHDUHGDQG'0$5[RSHUDWLRQLVVWRSSHG 2WKHUZLVHWKHGHVFULSWRULVUHDGDQGWKH'0$FRQWUROOHUVWDUWVDJDLQZLWKWKHQH[WGDWDDVGHVFULEHGLQWKH SUHYLRXVSDUDJUDSK :KHQWKH'0$UHDGVDGHVFULSWRULIWKHRZQHUVKLSELWLVQRWVHWLWKDVWZRRSWLRQV 6NLSWRWKHQH[WEXIIHUGHVFULSWRUZKHQ'5[676.ELWLV *HQHUDWHDQLQWHUUXSWDQGKDOWWKH'0$RSHUDWLRQZKHQ'5[676.ELWLV 'XULQJWUDQVPLVVLRQWKHWZRE\WHIUDPHOHQJWKDWWKH7[EXIIHUGHVFULSWRULVPRYHGWRWKH'0$LQWHUQDO7[UHJLVWHU $IWHUWUDQVPLVVLRQWKH7[VWDWXVLVVDYHGLQWKH7[EXIIHUGHVFULSWRU7KH'0$FRQWUROOHUWKHQXSGDWHVWKHQH[W EXIIHUGHVFULSWRUSRLQWHUIRUWKHOLQNHGOLVWVWUXFWXUH :KHQWKH'0$7[EXIIHUGHVFULSWRUUHJLVWHUSRLQWVWRWKHILUVWEXIIHUGHVFULSWRUWKHWUDQVPLWWHUVWDUWVWUDQVPLWWLQJ WKHIUDPHGDWDIURPWKHEXIIHUPHPRU\WR7[),)2 +'/&&21752//(56 .6&5,6&0,&52&21752//(5 %8))(5'(6&5,3725 75$160,7%8))(5'(6&5,3725 2 5HVHUYHG %XIIHU'DWD3RLQWHU 5HVHUYHG 7 %XIIHU/HQJWK 1H[W%XIIHU'HVFULSWRU3RLQWHU >@%XIIHU'DWD3RLQWHU >@2ZQHUVKLS2 7[&RQWURO%LWV >@3UHDPEOH3 &5&PRGH %LJ(QGLDQ :$ ' / ( 1 3 &38 '0$ 1RSUHDPEOH 3UHDPEOH >@7[1R&5&0RGH1 >@/LWWOH(QGLDQ0RGH( >@/DVW/ 1R&5&PRGH /LWWOH(QGLDQ 7KLVLVQRWWKHODVWEXIIHULQWKHIUDPH 7KLVLVWKHODVWEXIIHULQWKHIUDPH ,QFUHPHQW >@%XIIHU'DWD3RLQWHU'HFUHPHQW' >@:LGJHW$OLJPHQW&RQWURO:$ 'HFUHPHQW 1RLQYDOLGE\WHV ,QYDOLGE\WHV LQYDOLGE\WHV LQYDOLGE\WHV >@%XIIHU/HQJWK 7[6WDWXV%LW 7KHVHELWPD\EHUHJDUGHGDVYDOLGZKHQWKH/ELWLQ7[FRQWUROELWLVVHW >@7UDQVPLVVLRQ&RPSOHWLRQ7 1RUPDO 2QHIUDPHFRPSOHWHG >@1H[W%XIIHU'HVFULSWRU3RLQWHU 7KHDGGUHVVRIWKHQH[WEXIIHUGHVFULSWRU )LJXUH7UDQVPLW%XIIHU'HVFULSWRU .6&5,6&0,&52&21752//(5 +'/&&21752//(56 5(&(,9(%8))(5'(6&5,3725 2 %XIIHU'DWD3RLQWHU 5HVHUYHG 5HVHUYHG $ ' ) / / ) % 7 2 1 & & 7 0 9 2 ( ' 9 1H[W%XIIHU'HVFULSWRU3RLQWHU %XIIHU/HQJWK >@%XIIHU'DWD3RLQWHU >@2ZQHUVKLS2 &38 '0$ >@%XIIHU/HQJWK 5HFHLYHGEXIIHUOHQJWKVDUHZURWHWRWKLVEXIIHUGHVFULSWRU 5[6WDWXV%LWV 7KHVHELWVPD\EHUHJDUGHGDVYDOLGZKHQ/ELWLQ5[VWDWXVELWLVVHW >@&'/RVW&' 1RUPDO &'ORVWRFFXUV >@&5&(UURU&( 1RUPDO &5&HUURURFFXUVWRWKHIUDPHUHFHLYHG >@1RQRFWHW$OLJQHG)UDPH12 1RUPDO 1RQRFWHWDOLJQHGIUDPHLVUHFHLYHG >@2YHUUXQ29 1RUPDO 7KHUHFHLYHGIUDPHRYHUUXQV >@'3//7ZR0LVV'70 1RUPDO >@5[$ERUW$%7 '3//WZRPLVVFORFNRFFXUV 1RUPDO 7KHUHFHLYHGIUDPHDERUWHG >@)LUVW,Q)UDPH) >@/DVW,Q)UDPH/ 7KLVEXIIHUGHVFULSWRUVWDWXVLVQRWWKHILUVWWRWKHIUDPH 7KLVEXIIHUGHVFULSWRUVWDWXVLVWKHILUVWWRWKHIUDPH 7KLVEXIIHUGHVFULSWRUVWDWXVLVQRWWKHODVWWRWKHIUDPH 7KLVEXIIHUGHVFULSWRUVWDWXVLVWKHODVWWRWKHIUDPH >@)UDPH/HQJWK9LRODWLRQ)/9 1RUPDO 7KLVUHFHLYHGIUDPHOHQJWKH[FHHGVWKHYDOXHRIWKHPD[LPXPIUDPHOHQJWKUHJLVWHU >@1H[W%XIIHU'HVFULSWRU3RLQWHU 7KHDGGUHVVRIWKHQH[WEXIIHUGHVFULSWRU )LJXUH5HFHLYH%XIIHU'HVFULSWRU +'/&&21752//(56 .6&5,6&0,&52&21752//(5 5[%XIIHU 'HVFULSWRU 6WDUW$GGUHVV 3RLQWHU %XIIHU'DWD3RLQWHU 5HVHUYHG 6WDWXV %XIIHU/HQJWK 1H[W%XIIHU'HVFULSWRU %XIIHU'DWD3RLQWHU 5HVHUYHG 6WDWXV %XIIHU/HQJWK 1H[W%XIIHU'HVFULSWRU %XIIHU'DWD1 8QXVHG %XIIHU'DWD 8QXVHG 5[%XI6L]H 5HJLVWHU 9DOXH 5[%XI6L]H 5HJLVWHU 9DOXH %XIIHU'DWD 8QXVHG %XIIHU'DWD3RLQWHU1 5HVHUYHG 6WDWXV %XIIHU/HQJWK ,QVLQJOHOLQNHGOLVWVWKHQH[WEXIIHU GHVFULSWRULVILOOHGZLWKDQXOO DGGUHVV 1H[W%XIIHU'HVFULSWRU 127( %XIIHUOHQJWKLVDFFXPXODWHGXQWLOWKHODVWELWLVVHWLQ67$786 %XIIHUGDWDSRLQWHULQGLFDWHVWKHEXIIHUPHPRU\VWDUWDGGUHVV )LJXUH'DWD6WUXFWXUHRIWKH5HFHLYH'DWD%XIIHU .6&5,6&0,&52&21752//(5 +'/&&21752//(56 +'/&63(&,$/5(*,67(56 7KH+'/&VSHFLDOUHJLVWHUVDUHGHILQHGDVUHDGRQO\RUZULWHRQO\UHJLVWHUVDFFRUGLQJWRWKHGLUHFWLRQRILQIRUPDWLRQ IORZ7KHDGGUHVVHVRIWKHVHUHJLVWHUVDUHVKRZQLQ7DEOHDQG 7KHWUDQVPLWWHU),)2UHJLVWHUFDQEHDFFHVVHGXVLQJWZRGLIIHUHQWDGGUHVVHVWKHIUDPHWHUPLQDWHDGGUHVVDQGWKH IUDPHFRQWLQXHDGGUHVV7KHIXQFWLRQVRIWKHVHDGGUHVVHVDUHGLVFXVVHGLQGHWDLOLQWKH),)2VHFWLRQEHORZ 7DEOH+'/&&KDQQHO$6SHFLDO5HJLVWHUV 5HJLVWHUV +02'( +&21 +67$7 +,17(1 +7[),)2& )UDPH&RQWLQXH +7[),)27 )UDPH7HUPLQDWH +5;),)2 +%5*7& +350% +6$5 +6$5 +6$5 +6$5 +0$6. +'0$7;375 +'0$5;375 +0)/5 +5%65 2IIVHW$GGUHVV [ [ [ [F [ [ [ [F [ [ [ [F [ [ [ [F [ [ 5: 5: 5: 5: 5: : : 5 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 'HVFULSWLRQ +'/&PRGHUHJLVWHU +'/&FRQWUROUHJLVWHU +'/&VWDWXVUHJLVWHU +'/&,QWHUUXSW(QDEOH5HJLVWHU +7[),)2)UDPH&RQWLQXHUHJLVWHU +7[),)2)UDPH7HUPLQDWHUHJLVWHU +5;),)2(QWU\UHJLVWHU +'/&%5*WLPHFRQVWDQWUHJLVWHU +'/&3UHDPEOHUHJLVWHU +'/&6WDWLRQ$GGUHVV +'/&6WDWLRQ$GGUHVV +'/&6WDWLRQ$GGUHVV +'/&6WDWLRQ$GGUHVV +'/&0DVNUHJLVWHU '0$7[%XIIHU'HVFULSWRU3RLQWHU '0$5[%XIIHU'HVFULSWRU3RLQWHU 0D[LPXP)UDPH/HQJWKUHJLVWHU 5HFHLYH%XIIHU6L]HUHJLVWHU 5HVHW9DOXH [ [ [ [ [ [ [ [ [ [ [ [ [)))))))) [)))))))) [;;;; [;;;; +'/&&21752//(56 .6&5,6&0,&52&21752//(5 7DEOH+'/&&KDQQHO%6SHFLDO5HJLVWHUV 5HJLVWHUV +02'( +&21 +67$7 +,17(1 +7[),)2& )UDPH&RQWLQXH +7[),)27 )UDPH7HUPLQDWH +5;),)2 +%5*7& +350% +6$5 +6$5 +6$5 +6$5 +0$6. +'0$7;375 +'0$5;375 +0)/5 +5%65 2IIVHW [ [ [ [F [ [ [ [F [ [ [ [F [ [ [ [F [ [ 5: 5: 5: 5: 5: : : 5 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 'HVFULSWLRQ +'/&PRGHUHJLVWHU +'/&FRQWUROUHJLVWHU +'/&VWDWXVUHJLVWHU +'/&,QWHUUXSW(QDEOH5HJLVWHU +7[),)2)UDPH&RQWLQXHUHJLVWHU +7[),)2)UDPH7HUPLQDWHUHJLVWHU +5;),)2(QWU\UHJLVWHU +'/&%5*WLPHFRQVWDQWUHJLVWHU +'/&3UHDPEOHUHJLVWHU +'/&6WDWLRQ$GGUHVV +'/&6WDWLRQ$GGUHVV +'/&6WDWLRQ$GGUHVV +'/&6WDWLRQ$GGUHVV +'/&0DVNUHJLVWHU '0$7[%XIIHU'HVFULSWRU3RLQWHU '0$5[%XIIHU'HVFULSWRU3RLQWHU 0D[LPXP)UDPH/HQJWKUHJLVWHU 5HFHLYH%XIIHU6L]HUHJLVWHU 5HVHW9DOXH [ [ [ [ [ [ [ [ [ [ [ [ [)))))))) [)))))))) [;;;; [;;;; .6&5,6&0,&52&21752//(5 +'/&&21752//(56 +'/&*/2%$/02'(5(*,67(5 7DEOH+02'($DQG+02'(%5HJLVWHU 5HJLVWHUV +02'($ +02'(% 2IIVHW$GGUHVV [ [ 5: 5: 5: 'HVFULSWLRQ +'/&0RGHUHJLVWHU +'/&0RGHUHJLVWHU 5HVHW9DOXH [ [ 7DEOH+02'(5HJLVWHU'HVFULSWLRQ %LW 1XPEHU >@ >@ >@ %LW1DPH 'HVFULSWLRQ 0XOWL)UDPHLQ+7[),)2 ,IWKLVELWLVVHWPRUHWKDQRQHIUDPHFDQEHORDGHGLQWR+7[),)2,QWKLV LQ'0$RSHUDWLRQ0)) FDVHWKHIUDPHVL]HPD\EHOHVVWKDQWKH),)2VL]H 5HVHUYHG 5[/LWWOH(QGLDQPRGH 5[/LWWOH 1RWDSSOLFDEOH 7KLVELWGHWHUPLQHVZKHWKHUWKHGDWDLVLQ/LWWOHRU%LJHQGLDQIRUPDW +5;),)2LVLQ/LWWOHHQGLDQ,IWKLVELWLVVHWWRWKHQWKHGDWDRQWKH V\VWHPEXVVKRXOGEHLQ%LJHQGLDQ7KHUHIRUHWKHE\WHVZLOOEHVZDSSHG LQ%LJHQGLDQ 7KLVELWGHWHUPLQHVZKHWKHU7[GDWDLVLQ/LWWOHRU%LJHQGLDQ7[/LWWOH IRUPDW+7[),)2LVLQ/LWWOHHQGLDQ,IWKLVELWLVVHWWRWKHGDWDRQWKH V\VWHPEXVLV/LWWOHHQGLDQ,IWKLVELWLVVHWWRWKHGDWDRQ WKHV\VWHPEXVLVLQ%LJHQGLDQWKDWLVWKHGDWDE\WHVDUHVZDSSHGWREH /LWWOHHQGLDQIRUPDW 1RWDSSOLFDEOH 7KHVHELWVGHWHUPLQHWKHOHQJWKRISUHDPEOHWREHVHQWEHIRUHWKHRSHQLQJ IODJZKHQWKH7[350%ELWLVVHWLQWKHFRQWUROUHJLVWHU E\WHE\WHVDQGE\WHVZLOOEHVHQW :KHQWKH')ELWVDUHGDWDLVWUDQVPLWWHGDQGUHFHLYHGLQWKH15= GDWDIRUPDW:KHQ')LVWKH15=,]HURFRPSOHPHQWGDWDIRUPDWLV VHOHFWHG') VHOHFWVWKH)0GDWDIRUPDW') WKH)0GDWD IRUPDWDQG') WKH0DQFKHVWHUGDWDIRUPDW 1RWDSSOLFDEOH 8VLQJWKLVVHWWLQJ\RXFDQFRQILJXUHWKHFORFNVRXUFHIRU'3//WRRQHRI WKHIROORZLQJSLQV7;&5;&0&/.%5*287RU%5*2877RVHOHFW RQHRIWKHVHSLQVVHWWKH'3//&/.ELWVWRRU UHVSHFWLYHO\ ,IWKLVELWLV0&/.LVVHOHFWHGDVWKHVRXUFHFORFNIRUWKHEDXGUDWH JHQHUDWRU%5*,IWKLVELWLVWKHH[WHUQDOFORFNDWWKH5;&SLQLV VHOHFWHGDVWKH%5*VRXUFHFORFN 8VLQJWKLVVHWWLQJ\RXFDQFRQILJXUHWKHWUDQVPLWFORFNVRXUFHWRRQHRI WKHIROORZLQJSLQV7;&5;&'3//2877%5*287RU%5*287 7RVHOHFWRQHRIWKHVHSLQVVHWWKH7[&/.ELWVWRRU UHVSHFWLYHO\ >@ 7[/LWWOH(QGLDQPRGH 7[/LWWOH >@ >@ 5HVHUYHG 7[SUHDPEOH OHQJWK7[3/ 'DWDIRUPDWV') >@ >@ >@ 5HVHUYHG '3//FORFNVHOHFW '3//&/. >@ %5*FORFNVHOHFW %5*&/. 7[FORFNVHOHFW7[&/. >@ +'/&&21752//(56 .6&5,6&0,&52&21752//(5 7DEOH+02'(5HJLVWHU'HVFULSWLRQ %LW 1XPEHU >@ %LW1DPH 'HVFULSWLRQ 5[FORFNVHOHFW5[&/. 8VLQJWKLVVHWWLQJ\RXFDQFRQILJXUHWKHUHFHLYHFORFNVRXUFHWRRQHRIWKH IROORZLQJSLQV7;&5;&'3//2875%5*287RU%5*287 7RVHOHFWRQHRIWKHVHSLQVVHWWKH5[&/.ELWVWR RUUHVSHFWLYHO\ 7;&RXWSXWSLQVHOHFW 7;&236 ,I\RXGRQRWXVHWKHFORFNDWWKH7;&SLQDVWKHLQSXWFORFN\RXFDQXVH WKH7;&SLQWRPRQLWRU7[&/.5[&/.%5*287%5*287 '3//2877DQG'3//28757RVHOHFWWKHFORFN\RXZDQWWRPRQLWRU\VHW WKH7;&236WRRUUHVSHFWLYHO\ 1RWDSSOLFDEOH >@ >@ 5HVHUYHG .6&5,6&0,&52&21752//(5 +'/&&21752//(56 7;& 236 5[&/. 7[&/. % 5 * & / . '3// &/. ') 7;3/ 7 [ / L W W , H 5 [ / L W W , H 0 ) ) >@0XOWL)UDPHLQ7[),)2LQ'0$2SHDWLRP0)) 6LQJOHIUDPHLQ7[),)2 0XOWLIUDPHLQ7[),)2 >@5HVHUYHG >@5[/LWWOH(QGLDQ0RGH5[/LWWOH >@7[/LWWOH(QGLDQ0RGH7[/LWWOH >@5HVHUYHG >@7[3UHDPEOH/HQJWK7[3/ E\WH E\WH E\WH E\WH 7KH5[GDWDRQWKHV\VWHPEXVLVLQ%LJ(QGLDQIRUPDW 7KH5[GDWDRQWKHV\VWHPEXVLVLQ/LWWOH(QGLDQIRUPDW 7KH7[GDWDRQWKHV\VWHPEXVLVLQ%LJ(QGLDQIRUPDW 7KH7[GDWDRQWKHV\VWHPEXVLVLQ/LWWOH(QGLDQIRUPDW E\WH E\WH E\WH E\WH >@5HVHUYHG >@'DWD)RUPDW') 15=GDWDIRUPDW )0 0DQFKHVWHU 7;&SLQ 0&/. %5*287 15=, )0, >@5HVHUYHG >@'3//&ORFN6HOHFW'3//&/. 5;&SLQ %5*287 >@%5*&ORFN6HOHFW%5*&/. 5;&SLQLVVHOHFWHG 0&/.LVVHOHFWHG 7;&SLQ '3//2877 %5*287 >@7[&ORFN6HOHFW7[&/. 5;&SLQ %5*287 >@5HVHUYHG >@5[&ORFN6HOHFW5[&/. 7;&SLQ '3//2875 %5*287 5;&SLQ %5*287 >@5HVHUYHG >@7;&2XWSXW3LQ6HOHFW7;&236 7KLVSLQLVXVHGIRURXWSXWRQO\ZKHQLWLVQRWXVHGDVDQLQSXWFORFNIRUWKH'3//&/.7[&/. RU5[&/. 7;FORFN 5[FORFN %5*287 %5*287 '3//2877 '3//2875 >@5HVHUYHG )LJXUH+02'(5HJLVWHU +'/&&21752//(56 .6&5,6&0,&52&21752//(5 +'/&&21752/5(*,67(5 7DEOH+&21$DQG+&21%5HJLVWHU 5HJLVWHUV +&21$ +&21% 2IIVHW$GGUHVV [ [ 5: 5: 5: 'HVFULSWLRQ +'/&FKDQQHO$FRQWUROUHJLVWHU +'/&FKDQQHO%FRQWUROUHJLVWHU 5HVHW9DO [ [ 7DEOH+&215HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ >@ >@ >@ %LW1DPH 7[UHVHW7[56 5[UHVHW5[56 '0$7[UHVHW '7[56 '0$5[UHVHW '5[56 7[HQDEOH7[(1 'HVFULSWLRQ 6HWWKLVELWWRWRUHVHWWKH7[EORFN7[EORFNFRPSULVHV+7[),)2DQGD WUDQVPLWWHUEORFN 6HWWKLVELWWRWRUHVHWWKH5[EORFN5[EORFNFRPSULVHV+5;),)2DQG DUHFHLYHUEORFN 6HWWKLVELWWRWRUHVHWWKH'0$7[EORFN 6HWWKLVELWWRWRUHVHWWKH'0$5[EORFN :KHQWKH7[(1ELWLVWKHWUDQVPLWWHUHQWHUVDGLVDEOHGVWDWHDQGWKH OLQHEHFRPHVKLJKVWDWH,QWKLVFDVHWKHWUDQVPLWWHUEORFNLVFOHDUHG H[FHSWIRUWKH+7[),)2DQGWKHVWDWXVELWVDVVRFLDWHGZLWKWUDQVPLW RSHUDWLRQDUHFOHDUHG'DWDFDQQRWEHORDGHGLQWRWKH+7[),)2 ,IWKLVELWLVVHWWRWKHLGOHSDWWHUQLVVHQWFRQWLQXRXVO\,QWKLVFDVHWKH GDWDFDQEHORDGHGLQWR+7[),)2DQGWKHQVHQW :KHQWKH5[(1ELWLVWKHUHFHLYHUHQWHUVDGLVDEOHGVWDWHDQGFDQQRW GHWHFWWKHIODJSDWWHUQLIDQ\,QWKLVFDVHUHFHLYHUEORFNLVFOHDUHG H[FHSWIRUWKH+5;),)2DQGWKHVWDWXVELWVDVVRFLDWHGZLWKUHFHLYHU RSHUDWLRQDUHFOHDUHG'DWDFDQQRWEHUHFHLYHG ,IWKLVELWLVVHWWRWKHIODJSDWWHUQLVGHWHFWHG,QWKLVFDVHWKHGDWD UHFHLYHGFDQEHORDGHGLQWRWKH+5;),)2DQGPRYHGWRV\VWHP PHPRU\ 7KH'7[(1ELWOHWVWKH+'/&7[RSHUDWHRQDEXVV\VWHPLQ'0$PRGH :KHQ'0$7[LVHQDEOHGDQLQWHUUXSWUHTXHVWFDXVHGE\7[)$VWDWXVLV LQKLELWHGDQGWKH+'/&GRHVQRWXVHWKHLQWHUUXSWUHTXHVWWRUHTXHVWD GDWDWUDQVIHU'0$7[PRQLWRUVWKH+7[),)2DQGILOOVWKH+7[),)27KLV ELWLVDXWRGLVDEOHGZKHQ7[XQGHUUXQRFFXUVRU&76ORVWRUQH[WEXIIHU GHVFULSWRUSRLQWHUUHDFKQXOORUWKHRZQHUELWLVQRW'0$PRGHZKHQ '7[676.ELWLVVHW,I7[XQGHUUXQRFFXUV'7[$%7LQ+67$7ELWVHW DQGDERUWVLJQDOVHQGHG,I&76ORVWRFFXUV'7[$%7ELWVHWDQG7[' RXWSXWJRHVKLJKVWDWHDVORQJDV&76UHPDLQVKLJKOHYHO >@ 5[HQDEOH5[(1 >@ '0$7[HQDEOH '7[(1 .6&5,6&0,&52&21752//(5 +'/&&21752//(56 7DEOH+&215HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH '0$5[HQDEOH '5[(1 'HVFULSWLRQ 7KH'5[(1ELWOHWVWKH+'/&5[RSHUDWHRQDEXVV\VWHPLQ'0$PRGH :KHQ'0$5[LVHQDEOHGDQLQWHUUXSWUHTXHVWFDXVHGE\WKH5[)$ VWDWXVLVLQKLELWHGDQGWKH+'/&GRHVQRWXVHWKHLQWHUUXSWUHTXHVWWR UHTXHVWDGDWDWUDQVIHU'0$5[PRQLWRUVWKH+5;),)2DQGPRYHVWKH GDWDIURPWKH+5;),)2WRPHPRU\7KLVELWLVDXWRPDWLFDOO\GLVDEOHG ZKHQWKHQH[WEXIIHUGHVFULSWRUSRLQWHUEHFRPHVQXOORUWKHRZQHUELWLV QRWLQ'0$PRGHZKHQWKH'7[676.ELWLVVHW 6HWWLQJWKLVELWHQDEOHVWKH'3//FDXVLQJWKH'3//WRHQWHUVHDUFK PRGH,Q6HDUFKPRGHWKH'3//VHDUFKHVIRUDORFNLQJHGJHLQWKH LQFRPLQJGDWDVWUHDP $IWHU'3//LVHQDEOHGLQ15=,PRGHIRUH[DPSOHWKH'3//VWDUWV VDPSOLQJLPPHGLDWHO\DIWHUWKHILUVWHGJHLVGHWHFWHG,Q)0PRGHWKH '3//H[DPLQHVWKHFORFNHGJHRIHYHU\RWKHUELWWRGHFLGHZKDW FRUUHFWLRQPXVWEHPDGHWRUHPDLQLQV\QF,IWKH'3//GRHVQRWGHWHFW DQHGJHGXULQJWKHH[SHFWHGZLQGRZLWVHWVWKHRQHFORFNPLVVLQJELW ,IWKH'3//GRHVQRWGHWHFWDQHGJHDIWHUWZRVXFFHVVLYHDWWHPSWVLWVHWV WKHWZRFORFNPLVVLQJELWDQGWKH'3//DXWRPDWLFDOO\HQWHUVWKH6HDUFK PRGH7RUHVHWERWKFORFNVPLVVLQJODWFKHV\RXFDQGLVDEOHDQGUH HQDEOHWKH'3//XVLQJWKHUHVHW5[VWDWXV 7KLVELWFRQWUROVWKHRSHUDWLRQRIWKHEDXGUDWHJHQHUDWRU%5*7R HQDEOHWKH%5*FRXQWHUVHWWKH%5*(1ELWWR7RLQKLELWFRXQWLQJ FOHDUWKHELWWR :KHQWKLVELWLVDQG7[)$ELWLQVWDWXVUHJLVWHULVLWLVLQGLFDWHGWKDW 7[),)2LVHPSW\IRUZRUG,WPHDQVWKDWZRUGGDWDFDQEHORDGHGWR 7[),)2 6LPLODUO\ZKHQWKLVELWLVWKHVDPHVWDWXVUHJLVWHUELWLQGLFDWHWKDW ZRUGVRIGDWDFDQEHORDGHGWR7[),)2ZLWKRXWUHDGLQJWKHVWDWXVELWIRU DVHFRQGWLPH 6SHFLILFDOO\WKHVWDWXVUHJLVWHUELWDIIHFWHGE\WKHZRUGRUZRUG WUDQVIHUVHWWLQJDUHWKHWUDQVPLWGDWDDYDLODEOH7[)$ELW :KHQWKLVELWLVDQGWKH5[)$ELWLQWKHVWDWXVUHJLVWHULVLWLV LQGLFDWHGWKDW5[),)2KDVZRUGGDWD,WPHDQVWKDWZRUGGDWDFDQEH PRYHGWRPHPRU\ 6LPLODUO\ZKHQWKLVELWLVWKHVDPHVWDWXVUHJLVWHUELWLQGLFDWHVWKDW ZRUGVRIGDWDFDQEHPRYHGLQWKHPHPRU\ZLWKRXWUHDGLQJWKHVWDWXVELW IRUDVHFRQGWLPH 6SHFLILFDOO\WKHVWDWXVUHJLVWHUELWDIIHFWHGE\WKHZRUGRUZRUG WUDQVIHUVHWWLQJDUHWKHUHFHLYHGDWDDYDLODEOH5[)$ELWDQGWKHUHVLGXH E\WHVVWDWXVELWV5[5%>@ >@ '3//HQDEOH '3//(1 >@ %5*HQDEOH %5*(1 7[ZRUGPRGH 7[:' >@ >@ 5[ZRUGPRGH 5[:' >@ 5[ZLGJHW 7KHVHELWVGHWHUPLQHKRZPDQ\E\WHVDUHLQYDOLGLQWKHILUVWPHPRU\ DOLJQPHQW5[:$ ZRUGRIWKHIUDPHWREHUHFHLYHG7KHLQYDOLGE\WHVDUHLQVHUWHGZKHQWKH ZRUGLVDVVHPEOHGLQWKH+5;),)2 1R,QYDOLGE\WHV LQYDOLGE\WH LQYDOLGE\WHV LQYDOLGE\WHV '0$7[VWRSRU VNLS'7[676. 7KLVELWGHWHUPLQHVD'0$7[VWRSRUVNLSZKHQ'0$KDVQRWWKH RZQHUVKLSDVVRFLDWHGZLWKWKH7[EXIIHUGHVFULSWRU'0$7[LVGLVDEOHGLQ WKLVFRQGLWLRQZKHQWKLVELWLVVHW >@ +'/&&21752//(56 .6&5,6&0,&52&21752//(5 7DEOH+&215HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH '0$5[VWRSRU VNLS'5[676. '0$5[PHPRU\ DGGUHVV GHFUHPHQW '5[0$'(& 7[IODJLGOH 7[)/$* 'HVFULSWLRQ 7KLVELWGHWHUPLQHVD'0$5[VWRSRUVNLSZKHQ'0$KDVQRWWKH RZQHUVKLSDVVRFLDWHGZLWKWKH5[EXIIHUGHVFULSWRU,IWKLVELWLVVHW'0$ 5[LVGLVDEOHG 7KLVELWGHWHUPLQHVZKHWKHUWKHDGGUHVVLVLQFUHPHQWHGRUGHFUHPHQWHG ,IWKLVELWLVVHWWRWKHQWKHDGGUHVVZLOOEHGHFUHPHQWHG >@ >@ 7KLVELWVHOHFWVWKHIODJWLPHILOOPRGHDFWLYHLGOHRUWKHPDUNLGOHPRGH LQDFWLYHLGOHIRUWKHWUDQVPLWWHU7KHVHOHFWHGDFWLYHRULQDFWLYHLGOHVWDWH FRQWLQXHVXQWLOGDWDLVVHQWDIWHUQ5(6(7KDVUHWXUQWR+LJKOHYHO7KH IODJLGOHSDWWHUQLV(+WKHPDUNLGOHSDWWHUQLV))+ 7KLVELWFRQWUROVZKHWKHUVHSDUDWHFORVLQJDQGRSHQLQJIODJVDUH WUDQVPLWWHGLQVXFFHVVLRQWRGHOLPLWIUDPHV:KHQWKLVELWLV LQGHSHQGHQWRSHQLQJDQGFORVLQJIODJVDUHWUDQVPLWWHGLQRUGHUWR VHSDUDWHIUDPH :KHQWKLVELWLVVHWWRWKHFORVLQJIODJRIWKHFXUUHQWIUDPHVHUYHVDV WKHRSHQLQJIODJRIWKHQH[WIUDPH >@ 7[VLQJOHIODJ 7[6)/$* >@ 7[ORRSEDFNPRGH 7KLVELWLVXVHGIRUVHOIWHVWLQJ,IWKLVELWLVVHWWRWKHWUDQVPLWGDWD 7[/223 RXWSXW7['LVLQWHUQDOO\FRQQHFWHGWRWKHUHFHLYHUGDWDLQSXW5[',Q /RRSEDFNPRGHQ&76DQGQ'&'LQSXWVDUHLJQRUHG)RUQRUPDO RSHUDWLRQWKLVELWVKRXOGDOZD\VEH 5[HFKRPRGH 5[(&+2 6HWWLQJWKLVELWWRVHOHFWVWKHDXWRHFKRPRGHRIRSHUDWLRQ,QWKLV PRGHWKH7;'SLQLVFRQQHFWHGWR5;'DVLQORFDOORRSEDFNPRGHEXW WKHUHFHLYHUVWLOOPRQLWRUVWKH5;'LQSXW >@ >@ 7[DERUWH[WHQVLRQ :KHQWKLVELWLVVHWWRWKHDERUWSDWWHUQWKDWLVLQLWLDWHGZKHQ7[$%7 7[$%7(;7 LVH[WHQGHGWRDWOHDVWELWVRIVLQVXFFHVVLRQDQGWKHPDUNLGOH VWDWHLVHQWHUHG 7[DERUW7[$%7 :KHQWKLVELWLVVHWWRDQDERUWVHTXHQFHRIDWOHDVWHLJKWELWVRIVLV WUDQVPLWWHG7KHDERUWLVLQLWLDWHGDQGWKH+7[),)2LVFOHDUHG7[$%7LV WKHQFOHDUHGDXWRPDWLFDOO\E\KDUGZDUH :KHQWKLVELWLVVHWWRWKHFRQWHQWRIWKH+350%UHJLVWHULV WUDQVPLWWHGDVPDQ\7[3/ELWYDOXHVLQLQWHUUXSWPRGHLQVWHDGRIPDUN LGOHRUWLPHILOOPRGH7KLVLVXVHIXOIRUVHQGLQJWKHGDWDQHHGHGE\WKH '3//WRORFNWKHSKDVH,Q'0$PRGHWKLVELWLVPHDQLQJOHVV 7KH7['75ELWGLUHFWO\FRQWUROVWKHQ'75RXWSXWVWDWH6HWWLQJWKLVELW IRUFHVWKHQ'75SLQWR/RZOHYHO:KHQ\RXFOHDUWKH7['75ELWQ'75 JRHV+LJK :KHQWKLVELWLVVHWWKHIUDPHFXUUHQWO\UHFHLYHGLVLJQRUHGDQGWKHGDWD LQWKLVIUDPHLVGLVFDUGHG2QO\WKHODVWIUDPHUHFHLYHGLVDIIHFWHG7KHUH LVQRHIIHFWRQVXEVHTXHQWIUDPHVHYHQLIWKHQH[WIUDPHHQWHUVWKH UHFHLYHUZKHQWKHGLVFRQWLQXHELWLVVHW7KLVELWLVDXWRPDWLFDOO\FOHDUHG DIWHUDF\FOH :KHQWKLVELWLVVHWWRWKH&5&LVQRWDSSHQGHGWRWKHHQGRIDIUDPH E\KDUGZDUH >@ >@ 7[SUHDPEOH 7[350% >@ 7[GDWDWHUPLQDO UHDG\7['75 5[IUDPH GLVFRQWLQXH 5[',6&21 >@ >@ 7[QR&5& 7[12&5& .6&5,6&0,&52&21752//(5 +'/&&21752//(56 7DEOH+&215HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ %LW1DPH 5[QR&5& 5[12&5& $XWRHQDEOH $XWR(1 'HVFULSWLRQ :KHQWKLVELWLVVHWWRWKHUHFHLYHUGRHVQRWFKHFNIRU&5&E\ KDUGZDUH&5&GDWDLVDOZD\VPRYHGWRWKH+5;),)2 7KLVELWSURJUDPVWKHIXQFWLRQRIERWKQ'&'DQGQ&76+RZHYHU7[(1 DQG5[(1PXVWEHVHWEHIRUHWKHQ&76DQGQ'&'SLQVFDQEHXVHG :KHQWKLVELWLVLIWKHQ&76EHFRPHVKLJKWKHWUDQVPLWWHUVHQGVPDUN LGOHSDWWHUQ+RZHYHUWKRXJKWKHQ'&'EHFRPHVKLJKWKHUHFHLYHUFDQ UHFHLYHWKHGDWD :KHQWKLVELWLVLIWKHQ&76EHFRPHVKLJKWKHWUDQVPLWWHUVHQGPDUN LGOHEXWFOHDUVWKH+7[),)2DQGWKH7[EORFN,IQ'&'EHFRPHVKLJKWKH UHFHLYHUFDQWRSHUDWHDQGWKH+5;),)2DQG5[EORFNVDUHFOHDUHG 1RWDSSOLFDEOH >@ 5HVHUYHG +'/&&21752//(56 .6&5,6&0,&52&21752//(5 $ X W R ( 1 5 [ 1 2 & 5 & 7 [ 1 2 & 5 & 5 [ ' , 6 & 2 1 7 [ ' 7 5 7 [ 3 5 0 % 7 [ $ % 7 7 [ $ % 7 ( ; 7 5 [ ( & + 2 7 [ / 2 2 3 7 [ 6 ) / $ * 7 [ ) / $ * ' 5 [ 0 $ ' ( & ' 5 [ 6 7 6 . ' 7 [ 6 7 6 . 5 [ Z $ 5 [ : ' 7 [ : ' % 5 * ( 1 ' 3 / / ( 1 ' 5 [ ( 1 ' 7 [ ( 1 5 [ ( 1 7 [ ( 1 ' 5 [ 5 6 ' 7 [ 5 6 5 [ 5 6 7 [ 5 6 >@7[UHVHW7[56 1RUPDORSHUDWLRQ 1RUPDORSHUDWLRQ 1RUPDORSHUDWLRQ 1RUPDORSHUDWLRQ 7[GLVDEOHG >@5[UHVHW5[56 7[),)2DQG7[EORFNDUHUHVHW 5[),)2DQG5[EORFNDUHUHVHW '0$7[EORFNLVUHVHW >@'0$7[UHVHW'7[56 >@'0$5[UHVHW'5[56 >@7[HQDEOH7[(1 >@5[HQDEOH5[(1 5[GLVDEOHG '0$7[GLVDEOHG '0$5[EORFNLVUHVHW 7[HQDEOHG 5[HQDEOHG '0$7[HQDEOHG '0$5[HQDEOHG >@'0$7[HQDEOH'7[(1 '0$5[GLVDEOHG >@'0$5[HQDEOH'5[(1 >@'3//HQDEOH'3//(1 'LVDEOH (QDEOH'3//HQWHUVVHDUFKPRGHIRUDORFNLQJHGJHLQWKHLQFRPLQJ GDWDVWUHDP >@%5*HQDEOH%5*(1 %5*FRXQWHULVLQKLELWHG %5*FRXQWHULVHQDEOHG ZRUGPRGHVHOHFWHG ZRUGPRGHVHOHFWHG 1RLQYDOLGE\WH LQYDOLGE\WH LQYDOLGE\WHV LQYDOLGE\WHV >@7[ZRUGEXUVWPRGH7[:' >@5[ZRUGEXUVWPRGH5[:' >@5[ZLGJHWDO LJQPHQW5[:$ ZRUGPRGHVHOHFWHG ZRUGPRGHVHOHFWHG >@'0$7[VWRSRUVNLS'7[676. '0$7[VNLSVZKHQ'0$QRWRZQHUELWLVVHW '0$7[VWRSVZKHQ'0$QRWRZQHUELWLVVHW >@'0$5[VWRSRUVNLS'5[676. '0$5[VNLSVZKHQ'0$QRWRZQHUELWLVVHW '0$5[VWRSVZKHQ'0$QRWRZQHUELWLVVHW >@'0$5[PHPRU\DGGUHVVGHFUHPHQW'5[0$'(& $GGUHVVLVLQFUHPHQWHG $GGUHVVLVGHFUHPHQWHG >@7[IODJLGOH7[)/$* (QWHUPDUNLGOHPRGHDELWSDWWHUQRIFRQVHFXWLYHRQHV (QWHUWLPHILOOPRGHDELWSDWWHUQRIFRQVHFXWLYHRSHQLQJFORVLQJIODJDV LQVWULQJ )LJXUH+'/&&RQWURO5HJLVWHU+&21 .6&5,6&0,&52&21752//(5 +'/&&21752//(56 $ X W R ( 1 5 [ 1 2 & 5 & 7 [ 1 2 & 5 & 5 [ ' , 6 & 2 1 7 [ ' 7 5 7 [ 3 5 0 % 7 [ $ % 7 7 [ $ % 7 ( ; 7 5 [ ( & + 2 7 [ / 2 2 3 7 [ 6 ) / $ * 7 [ ) / $ * ' 5 [ 0 $ ' ( & ' 5 [ 6 7 6 . ' 7 [ 6 7 6 . 5 [ Z $ 5 [ : ' 7 [ : ' % 5 * ( 1 ' 3 / / ( 1 ' 5 [ ( 1 ' 7 [ ( 1 5 [ ( 1 7 [ ( 1 ' 5 [ 5 6 ' 7 [ 5 6 5 [ 5 6 7 [ 5 6 >@7[VLQJOHIODJ7[6)/$* 'RXEOHIODJPRGHDFORVLQJRSHQLQJIODJVDUHXVHGWRVHSDUDWHIUDPHV 6LQJOHIODJPRGHRQO\RQHIODJVDUHXVHGWRVHSDUDWHIUDPHV >@7[ORRSEDFNPRGH7[/223 1RUPDORSHUDWLRQ 7KHWUDQVPLWGDWDRXWSXWLVLQWHUQDOO\FRQQHFWHGWRWKHUHFHLYHUGDWDLQSXWIRUVHOI WHVWLQJ >@5[HFKRPRGH5[(&+2 'LVDEOH5[DXWRHFKRPRGH (QDEOH5['0$7[EORFNLVUHVHW >@7[DERUWH[WHQVLRQ7[$%7(;7 >@7[DERUW7[$%7 $WOHDVWFRQVHFXWLYHHLJKWVDUHWUDQVIHUHG $WOHDVWFRQVHFXWLYHVDUHWUDQVIHUUHG 1RUPDO (QDEOHDWOHDVWHLJKWFRQVHFXWLYHVDUHWUDQVPLWWHG >@7[SUHDPEOH7[350% 7UDQVPLWDPDUNLGOHRUWLPHILOOELWSDWWHUQ 7UDQVPLWWKHFRQWHQWRI+350% Q'75JRHVKLJKOHYHO Q'75JRHVORZOHYHO >@7[GDWDWHUPLQRORJ\UHDG\7['75 >@5[IUDPHGLVFRQWLQXH5[',6&21 1RUPDO ,JQRUHWKHFXUUHQWO\UHFHLYHGIUDPH >@7[1R&5&7[12&5& 'LVDEOH &5&LVQRWDSSHQGHGE\KDUGZDUH >@5[1R&5&5[12&5& 'LVDEOH 5HFHLYHUGRHVQRWFKHFN&5&E\KDUGZDUH &5&LVWUHDWHGDVGDWDLQDQ\FDVH >@$XWRHQDEOH$XWR(1 1RUPDORSHUDWLRQ7KHQ&76DQGQ'&'EHFRPHKLJKWKHWUDQVPLWWHUVHQGV PDUNLGOHDQGUHFHLYHUUHFHLYHVGDWD 7KHQ'&'DQGQ&76EHFRPHKLJK5[),)25[EORFN7[),)2DQG 7[EORFNDUHFOHDUHG7KHWUDQVPLWWHUVHQGVPDUNLGOHDQGWKHUHFHLYHUGRHVQRW RSHUDWH >@5HVHUYHG )LJXUH+'/&&RQWURO5HJLVWHU+&21 +'/&&21752//(56 .6&5,6&0,&52&21752//(5 +'/&67$7865(*,67(5+67$7 127( 5HDGLQJWKH+'/&VWDWXVUHJLVWHULVDQRQGHVWUXFWLYHSURFHVV7KHPHWKRGXVHGWRFOHDUD+LJK OHYHOVWDWXVFRQGLWLRQGHSHQGVRQWKHELWVIXQFWLRQDQGRSHUDWLRQPRGH'0$RULQWHUUXSW)RU GHWDLOVSOHDVHVHHWKHGHVFULSWLRQRIHDFKVWDWXVUHJLVWHU 7DEOH+67$7$DQG+67$7%5HJLVWHU 5HJLVWHUV +67$7$ +67$7% 2IIVHW$GGUHVV [ [ 5: 5: 5: 'HVFULSWLRQ +'/&&KDQQHO$6WDWXV5HJLVWHU +'/&&KDQQHO%6WDWXV5HJLVWHU 5HVHW9DOXH ; ; 6800$5< 7KHUHDUHWZRNLQGVRIELWVLQDVWDWXVUHJLVWHU 7[)$7[&765[)$5['&'5[)95[&5&(5[125[,(55DQG5[29ELWVDUHVKRZHDFKELWVVWDWXV 7KHVHELWVDUHVHWRUFOHDUHGDXWRPDWLFDOO\DFFRUGLQJWRWKHHDFKELWVWDWXV $OORWKHUELWVDUHFOHDUHGE\WKH&38ZULWLQJWRHDFKELW .6&5,6&0,&52&21752//(5 +'/&&21752//(56 7DEOH+67$75HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 'HVFULSWLRQ 5[UHPDLQLQJE\WHV 5[5%LQGLFDWHVKRZPDQ\GDWDE\WHVDUHYDOLGLQDZRUGRUZRUG 5[5% ERXQGDU\ZKHQWKHUHFHLYHUKDVUHFHLYHGDFRPSOHWHIUDPH,QZRUG WUDQVIHUPRGHWKH5[5%YDOXHLVHLWKHURU,QZRUGPRGHLWLV RU 7[IUDPHFRPSOHWH 7KLVVWDWXVELWLVDXWRPDWLFDOO\VHWWRZKHQWKHWZRFRQGLWLRQVDUHPHW 7[)& WKHUHLVQRGDWDLQWKH7[),)2DQGHLWKHUDQDERUWRUDFORVLQJIODJLV WUDQVPLWWHG<RXFDQFOHDUWKLVELWE\ZULWLQJWRWKLVELW 7[),)2DYDLODEOH 7[)$ ,IWKLVELWLVWKHGDWDWREHVHQWFDQEHORDGHGLQWRWKH+7[),)2UHJLVWHU ,QZRUGWUDQVIHUPRGHWKH7[)$VWDWXVELWLVVHWWRZKHQWKHILUVW UHJLVWHURIWKH+7[),)2LVHPSW\ ,QZRUGWUDQVIHUPRGH7[)$ ZKHQWKHILUVWIRXUELWUHJLVWHUVRIWKH +7[),)2DUHHPSW\7KH7[)$VWDWXVFRQGLWLRQLVDXWRPDWLFDOO\FOHDUHG ZKHQ+7[),)2LVQRORQJHUDYDLODEOH'XULQJ'0$7[RSHUDWLRQWKLVELWLV DOZD\VVRQRWJHQHUDWLQJLQWHUUXSW 7KHQ&76LQSXWLVSURMHFWHGWRWKLVVWDWXVELW,IWKHOHYHODWWKHQ&76LQSXW SLQLV/RZWKLVVWDWXVELWLV,IQ&76LQSXWSLQLV+LJKOHYHO7[&76LV 7KLVELWGRHVQRWJHQHUDWHDQLQWHUUXSW 7KLVELWLVVHWWRHDFKWLPHDWUDQVLWLRQLQQ&76LQSXWRFFXUV<RXFDQ FOHDUWKLVELWE\ZULWLQJWRWKLVELW :KHQWKHWUDQVPLWWHUUXQVRXWRIGDWDGXULQJDIUDPHWUDQVPLVVLRQDQ XQGHUUXQRFFXUVDQGWKHIUDPHLVDXWRPDWLFDOO\WHUPLQDWHGE\WUDQVPLWWLQJ DQDERUWVHTXHQFH7KHXQGHUUXQFRQGLWLRQLVLQGLFDWHGZKHQ7[8LV<RX FDQFOHDUWKLVELWE\ZULWLQJDWRWKLVELW 7KLVVWDWXVELWLQGLFDWHVZKHQWKHGDWDUHFHLYHGFDQEHUHDGIURPWKH5[ ),)2:KHQ5[)$LVLWLQGLFDWHVWKDWGDWDRWKHUWKDQDQDGGUHVVRUD ILQDOGDWDZRUGLVDYDLODEOHLQWKH+5;),)2,QZRUGWUDQVIHUPRGH5[)$ ELWVHWWRZKHQUHFHLYHGGDWDLVDYDLODEOHLQWKHODVW),)2UHJLVWHU,Q ZRUGWUDQVIHUPRGHLWLVVHWWRZKHQWKHGDWDUHFHLYHGLVDYDLODEOHLQWKH ODVWIRXUELW),)2UHJLVWHUV(YHQLIWKHGDWDUHVLGHLQ),)2IRURQO\WZR ZRUGVZKHQWKH/DVWELWLVVHW5[),)2LVUHJDUGHGDVYDOLG7KHUHFHLYHG GDWDDYDLODEOHFRQGLWLRQLVFOHDUHGDXWRPDWLFDOO\ZKHQWKHGDWDUHFHLYHGLV QRORQJHUDYDLODEOH'XULQJ'0$5[RSHUDWLRQWKLVELWLVDOZD\VVRGRHV QRWJHQHUDWHDQLQWHUUXSW 1RWDSSOLFDEOH 7KLVELWLVVHWWRZKHQWKHODVWELWRIWKHIODJVHTXHQFHLVUHFHLYHG7KLVELW JHQHUDWHVDQLQWHUUXSWLIHQDEOHG<RXFDQFOHDUWKLVELWE\ZULWLQJD WRWKLVELW 7KH'&'VWDWXVELWPLUURUVWKHVWDWHRIWKHQ'&'LQSXWSLQ,IQ'&'LQSXWSLQ LVORZWKLVVWDWXVELWLV,IQ'&'LQSXWSLQLV+LJKLWLV7KLVELWGRHVQRW JHQHUDWHDQLQWHUUXSW 7KLVELWLVVHWWRZKHQDWUDQVLWLRQLQQ'&'LQSXWRFFXUVDQGFDQ JHQHUDWHLQWHUUXSWLIHQDEOHG<RXFDQFOHDUWKLVELWE\ZULWLQJDWRWKLVELW >@ >@ >@ 7[FOHDUWRVHQG 7[&76 7[VWRUHGFOHDUWR VHQG7[6&76 7[XQGHUUXQ7[8 >@ >@ >@ 5[),)2DYDLODEOH 5[)$ >@ >@ 5HVHUYHG 5[IODJGHWHFWHG 5[)' 5[GDWDFDUULHU GHWHFWHG5['&' 5[VWRUHGGDWD FDUULHUGHWHFWHG 5[6'&' >@ >@ +'/&&21752//(56 .6&5,6&0,&52&21752//(5 7DEOH+67$75HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 5[IUDPHYDOLG 5[)9 5[LGOH5[,'/( 'HVFULSWLRQ 7KLVELWVLJQDOVIUDPHVHQGLQJERXQGDU\WRWKH&38DQGDOVRLQGLFDWHVWKDW QRIUDPHHUURURFFXUUHG,WLVVHWZKHQWKHODVWGDWDE\WHRIDIUDPHLV WUDQVIHUUHGLQWRWKHODVWORFDWLRQRIWKH5[),)2DQGLVDYDLODEOHWREHUHDG 7KH5[,'/(VWDWXVELWLQGLFDWHVWKDWDPLQLPXPRIFRQVHFXWLYHVKDYH EHHQUHFHLYHG7KHHYHQWLVVWRUHGLQWKHVWDWXVUHJLVWHUDQGFDQEHXVHGWR WULJJHUDUHFHLYHULQWHUUXSW7KH5[,'/(ELWFRQWLQXHVWRUHIOHFWWKHLQDFWLYH LGOHFRQGLWLRQXQWLODLVUHFHLYHG<RXFDQFOHDUWKLVELWE\ZULWHLQJDWR WKLVELW 7KH5[$%7VWDWXVELWLVVHWWRZKHQVHYHQRUPRUHFRQVHFXWLYHVDERUW VHTXHQFHKDYHEHHQUHFHLYHG:KHQDQDERUWLVUHFHLYHGLQDQLQIUDPH FRQGLWLRQWKHHYHQWLVVWRUHGLQWKHVWDWXVUHJLVWHUWULJJHULQJDQLQWHUUXSW UHTXHVW<RXFDQFOHDUWKLVELWE\ZULWHLQJDWRWKLVELW 7KH5[&5&(VWDWXVELWLVVHWDIUDPHLVFRPSOHWHGZLWKD&5&HUURU >@ >@ 5[DERUW5[$%7 >@ >@ >@ 5[&5&HUURU 5[&5&( 5[QRQRFWHWDOLJQ 7KH5[12ELWLVVHWWRLIUHFHLYHGGDWDLVQRQRFWHWDOLJQHGIUDPH 5[12 5[RYHUUXQ5[29 7KH5[29VWDWXVELWLVVHWWRLIWKHGDWDUHFHLYHGLVWUDQVIHUUHGLQWRWKH +5;),)2ZKHQLWLVIXOOUHVXOWLQJLQDORVVRIGDWD&RQWLQXHGRYHUUXQV GHVWUR\GDWDLQWKHILUVW),)2UHJLVWHU '0$5[PHPRU\ RYHUIORZ5[029 5HVHUYHG '0$7[DERUW '7[$%7 5[LQWHUQDOHUURU 5[,(55 '0$5[IUDPH GRQHHYHU\ UHFHLYHGIUDPH '5[)' '0$5[QXOOOLVW '5[1/ 7KLVELWLVVHWZKHQWKHUHLVQRPRUHEXIIHUGXULQJUHFHLYLQJGDWD,IWKLVELWLV VHW'5[(1ELWLVFOHDUHG<RXFDQFOHDUWKLVELWE\ZULWHLQJWRWKLVELW 1RWDSSOLFDEOH 7KLVELWLVVHWWRZKHQDERUWVLJQDOLVVHQGHGGXHWRWKH7[XQGHUUXQRU &76ORVWRFFXUUHG,IWKLVELWLVVHW'7[(1LQ+&21ELWFOHDUHG<RXFDQ FOHDUWKLVELWE\ZULWHLQJWRWKLVELW 7KLVELWLVVHWWRZKHQUHFHLYHGIUDPHZLOOEHGHWHFWHGHUURUSRVVLELOLW\GXH WRWKHUHFHLYHFORFNLVXQVWDEOH 7KLVELWLVVHWZKHQD'0$5[RSHUDWLRQKDVVXFFHVVIXOO\RSHUDWHGDIUDPH WRPHPRU\IURP+5;),)2DQGZKHQWKHODVWE\WHRIDIUDPHKDVEHHQ ZULWWHQWRPHPRU\7KLVELWJHQHUDWHLQWHUUXSWZKHQVHWWRWRNQRZDIUDPH LVUHFHLYHG<RXFDQFOHDUWKLVELWE\ZULWLQJWRWKLVELW ,IWKLVELWLVVHWWKH'0$5[EXIIHUGHVFULSWRUSRLQWHUKDVDQXOODGGUHVV,Q WKLVFDVH'0$5[LVGLVDEOHGDQGWKHGDWDWUDQVIHUIURPWKH5[),)2WR EXIIHUPHPRU\LVGLVFRQWLQXHG6RWKH+5;),)2LVFOHDUHG<RXFDQFOHDU WKLVELWE\ZULWLQJWRWKLVELW >@ >@ >@ >@ >@ >@ >@ '0$5[QRWRZQHU 7KLVELWLVVHWZKHQ'0$LVQRWRZQHURIWKHFXUUHQWEXIIHUGHVFULSWRUDQG '5[12 '5[676.ELWZDVVHW,QWKLVFDVH'0$5[LVGLVDEOHGDQGFDQJHQHUDWH LQWHUUXSWLIHQDEOHG,I'5[676.ELWLV]HURWKLVELWLVDOZD\V]HUR<RXFDQ FOHDUWKLVELWE\ZULWLQJWRWKLVELW '0$7[IUDPH GRQH'7[)' 7KLVELWLVVHWWRZKHQ'0$7[RSHUDWLRQKDVVXFFHVVIXOO\WUDQVIHUUHGD IUDPHIURPPHPRU\WR7[),)2<RXFDQFOHDUWKLVELWE\ZULWLQJWRWKLVELW >@ .6&5,6&0,&52&21752//(5 +'/&&21752//(56 7DEOH+67$75HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH '0$7[QXOOOLVW '7[1/ 'HVFULSWLRQ ,IWKLVELWLVVHWWKH'0$7[EXIIHUGHVFULSWRUSRLQWHUKDVDQXOODGGUHVV,Q WKLVFDVH'0$7[LVGLVDEOHGDQGWKHGDWDWREHWUDQVIHUUHGGLVFRQWLQXHG IURPWKHEXIIHUPHPRU\WR7[),)2<RXFDQFOHDUWKLVELWE\ZULWLQJWRWKLV ELW >@ '0$7[QRWRZQHU 7KLVELWLVVHWZKHQ'0$LVQRWRZQHURIWKHFXUUHQWEXIIHUGHVFULSWRUDQG '7[12 '7[676.ELWZDVVHW,QWKLVFDVH'0$7[GLVDEOHGDQGFDQJHQHUDWH LQWHUUXSWLIHQDEOHG,I'7[676.ELWLV]HURWKLVELWLVDOZD\V]HUR<RXFDQ FOHDUWKLVELWE\ZULWLQJWRWKLVELW '3//RQHFORFN PLVVLQJ '3//20 '3//WZRFORFN PLVVLQJ '3//70 :KHQRSHUDWLQJLQ)00DQFKHVWHUPRGHWKH'3//VHWVWKLVELWWRLILW GRHVQRWGHWHFWDQHGJHLQLWVILUVWDWWHPSW<RXFDQFOHDUWKLVELWE\ZULWLQJD WRWKLVELW :KHQLWLVRSHUDWLQJLQWKH)00DQFKHVWHUPRGHWKH'3//VHWVWKLVELWWR LILWGRHVQRWGHWHFWDQHGJHLQWZRVXFFHVVLYHDWWHPSWV$WWKHVDPHWLPH WKH'3//HQWHUV6HDUFKPRGH,Q15=15=,PRGHDQGZKLOHWKH'3//LV GLVDEOHGWKLVELWLVDOZD\V<RXFDQFOHDUWKLVELWE\ZULWLQJDWRWKLVELW >@ >@ +'/&&21752//(56 .6&5,6&0,&52&21752//(5 ' 3 / / 7 0 ' 3 / / 2 0 ' 7 [ 1 2 ' 7 [ 1 / ' 7 [ ) ' ' 5 [ 1 2 ' 5 [ 1 / ' 5 [ ) ' 5 [ , ( 5 5 ' 7 [ $ % 7 5 [ 0 2 9 5 [ 2 9 5 [ 1 2 5 [ & 5 & ( 5 [ $ % 7 5 [ , ' / ( 5 [ ) 9 5 [ 6 ' & ' 5 [ ' & ' 5 [ ) ' 5 7 7 7 7 [ [ [ [ [ ) 8 6 & ) $ & 7 $ 7 6 6 7 [ ) & 5 [ 5 % >@5[UHPDLQLQJE\WHV5[5% $WZRUGERXQGDU\ $WZRUGERXQGDU\ 9DOLGGDWDE\WHLV 9DOLGGDWDE\WHLV 9DOLGGDWDE\WHLV 9DOLGGDWDE\WHLV 9DOLGGDWDE\WHLV 9DOLGGDWDE\WHLV >@7[IUDPHFRPSOHWH7[)& 1RUPDORSHUDWLRQ $XWRPDWLFDOO\VHWLIWZRFRQGLWLRQVDUHPHW 7[),)2LVHPSW\ $QDERUWRUDFORVLQJIODJLVWUDQVPLWWHG >@7[),)2DYDLODEOH7[)$ 7[),)2LVQRWDYDLODEOH 7[),)2LVDYDLODEOHWKDWLVWKHGDWDWREHWUDQVPLWWHGFDQQRZEH ORDGHGLQWRWKH7[),)2 >@7[FOHDUWRVHQG7[&76 /HYHODWWKHQ&76LQSXWSLQLV+LJK /HYHODWWKHQ&76LQSXWSLQLV/RZ >@7[VWRUHGFOHDUWRVHQG7[6&76 1RUPDORSHUDWLRQ $WUD QVLWLRQRFFXUUHGDWWKHQ&76LQSXW7KLVWUDQVLWLRQFDQEHXVHGWR WULJJHUDQLQWHUUXSW >@7[XQGHUUXQ7[8 1RUPDORSHUDWLRQ 7KHWUDQVPLWWHUUDQRXWRIGDWDGXULQJWUDQVPLVVLRQ >@5[),)2DYDLODEOH5[)$ >@5HVHUYHG >@5[IODJGHWHFWHG5[)' 1RUPDORSHUDWLRQ 'DWDLVDYDLODEOHLQWKH5[),)2 1RUPDORSHUDWLRQ 7KLVELWLVVHWZKHQWKHODVWELWRIWKHIODJVHTXHQFHLVUHFHLYHG >@5[GDWDFDUULHUGHWHFWHG5['&' Q'&'LQSXWSLQLV+LJK Q'&'LQSXWSLQLV/RZ >@5[VWRUHGGDWDFDUULHUGHWHFWHG5[6'&' >@5[IUDPHYDOLG5[)9 1RUPDORSHUDWLRQ :KHQDWUDQVLWLRQRIWKHQ'&'LQSXWRFFXUVWKLVELWLVVHW 1RUPDORSHUDWLRQ 7KHODVWGDWDE\WHRIDIUDPHLVWUDQVIHUUHGLQWRWKHODVWORFDWLRQ RI5[),)2 >@5[LGOH5[,'/( 1RUPDORSHUDWLRQ $PLQLPXPFRQVHFXWLYHVKDYHEHHQUHFHLYHG )LJXUH+'/&6WDWXV5HJLVWHU .6&5,6&0,&52&21752//(5 +'/&&21752//(56 ' 3 / / 7 0 ' 3 / / 2 0 ' 7 [ 1 2 ' 7 [ 1 / ' 7 [ ) ' ' 5 [ 1 2 ' 5 [ 1 / ' 5 [ ) ' 5 [ , ( 5 5 ' 7 [ $ % 7 5 [ 0 2 9 5 [ 2 9 5 [ 1 2 5 [ & 5 & ( 5 [ $ % 7 5 [ , ' / ( 5 [ ) 9 5 [ 6 ' & ' 5 [ ' & ' 5 [ ) ' 5 7 7 [ [ [ ) 8 6 $ & 7 6 7 [ & 7 6 7 [ ) $ 7 [ ) & 5 [ 5 % >@5[DERUW5[$%7 1RUPDORSHUDWLRQ 6HYHQRUPRUHFRQVHFXWLYHVKDYHEHHQUHFHLYHGLQIUDPHFRQGLWLRQ >@5[&5&HUURU5[&5&( 1RUPDORSHUDWLRQ $IUDPH5[RSHUDWLRQLVFRPSOHWHGZLWKD&5&HUURU >@5[QRQRFWHWDOLJQ5[12 5HFHLYHGIUDPHLVRFWHW 5HFHLYHGIUDPHLVQRWRFWHW >@5[RYHUUXQ5[29 1RUPDORSHUDWLRQ 5HFHLYHGGDWDLVWUDQVIHUUHGLQWRWKH5[),)2ZKHQLWLVIXOO >@5[PHPRU\RYHUIORZ5[029 >@5HVHUYHG >@'0$7[DERUW'7[$%7 1RUPDORSHUDWLRQ ,QGLFDWHVPHPRU\RYHUIORZZKHQ5[EXIIHUGHVFULSWRUQH[WSRLQWHUKDVQXOODGGUHVV 1RUPDORSHUDWLRQ $ERUWVLJQDOLVVHQGHGDQG'0$7[HQDEOHELWLVFOHDUHG >@5[LQWHUQDOHUURU5[,(55 1RUPDORSHUDWLRQ 5HFHLYHGIUDPHLVQRWVWDEOHGXHWRUHFHLYHFORFNLVXQVWDEOH >@'0$5[IUDPHGRQHHYHU\UHFHLYHGIUDPH'5[)' >@'0$5[QXOOOLVW'5[1/ 1RUPDORSHUDWLRQ '0$5[RSHUDWLRQKDVVXFFHVVIXOO\WUDQVIHUUHGDIUDPHIURP5[),)2WREXIIHUPHPRU\ 1RUPDORSHUDWLRQ '0$5[EXIIHUGHVFULSWRUSRLQWHUKDVDQXOODGGUHVV >@'0$5[QRWRZQHU'5[12 '0$KDVWKHRZQHUVKLS &38KDVWKHRZQHUVKLS >@'0$7[IUDPHGRQH'7[)' >@'0$7[QXOOOLVW'7[1/ 1RUPDORSHUDWLRQ '0$7[RSHUDWLRQKDVVXFFHVVIXOO\WUDQVIHUUHGDIUDPHIURPPHPRU\WR7[),)2 1RUPDORSHUDWLRQ '0$7[EXIIHUGHVFULSWRUSRLQWHUKDVDQXOODGGUHVV >@'0$7[QRWRZQHU'7[12 '0$KDVWKHRZQHUVKLS &38KDVWKHRZQHUVKLS >@'3//RQHFORFNPLVVLQJ'3//20 >@'3//WZRFORFNPLVVLQJ'3//70 1RUPDORSHUDWLRQ 6HWLQ)00DQFKHVWHUPRGHZKHQ'3//GRHVQRWGHWHFWDQHGJHRQWKHILUVWHQWU\ 1RUPDORSHUDWLRQ '3//ZDVQRWGHWHFWHGRQWZRFRQVHFXWLYHHGJHVDQGVHDUFKPRGHZDVHQWHUHG )LJXUH+'/&6WDWXV5HJLVWHU&RQWLQXHG +'/&&21752//(56 .6&5,6&0,&52&21752//(5 +'/&,17(55837(1$%/(5(*,67(5+,17(1 7DEOH+,17(1$DQG+,17(1%5HJLVWHU 5HJLVWHUV +,17(1$ +,17(1% 2IIVHW$GGUHVV [F [F 5: 5: 5: 'HVFULSWLRQ +'/&,QWHUUXSW(QDEOH5HJLVWHU +'/&,QWHUUXSW(QDEOH5HJLVWHU 5HVHW9DOXH ; ; 7DEOH+,17(15HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ %LW1DPH 5HVHUYHG 7[)&,( 7[)$,( 5HVHUYHG 7[6&76,( 7[8,( 5[)$,( 5HVHUYHG 5[)',( 5HVHUYHG 5[6'&',( 5[)9,( 5[,'/(,( 5[$%7,( 5[&5&(,( 5[12,( 5[29,( 5[029,( 5HVHUYHG '7[$%7,( 5[,(55,( '5[)',( '5[1/,( '5[12,( '7[)',( '7[1/,( '0$7[DERUWLQWHUUXSWHQDEOH 5[LQWHUQDOHUURULQWHUUXSWHQDEOH '0$5[IUDPHGRQHLQWHUUXSWHQDEOH '0$5[QXOOOLVWLQWHUUXSWHQDEOH '0$5[QRWRZQHULQWHUUXSWHQDEOH '0$7[IUDPHGRQHHYHU\WUDQVPLWWHGIUDPHLQWHUUXSWHQDEOH '0$7[QXOOOLVWLQWHUUXSWHQDEOH '&'WUDQVLWLRQLQWHUUXSWHQDEOH 5[IUDPHYDOLGLQWHUUXSWHQDEOH ,GOHGHWHFWHGLQWHUUXSWHQDEOH $ERUWGHWHFWHGLQWHUUXSWHQDEOH &5&HUURUIUDPHLQWHUUXSWHQDEOH 1RQRFWHWDOLJQHGIUDPHLQWHUUXSWHQDEOH 5[RYHUUXQLQWHUUXSWHQDEOH 5[PHPRU\RYHUIORZLQWHUUXSWHQDEOH 'HVFULSWLRQ 7[IUDPHFRPSOHWHLQWHUUXSWHQDEOH 7[),)2DYDLODEOHWRZULWHLQWHUUXSWHQDEOH &76WUDQVLWLRQKDVRFFXUUHGLQWHUUXSWHQDEOH 7[XQGHUUXQKDVRFFXUUHGLQWHUUXSWHQDEOH 5[),)2DYDLODEOHWRUHDGLQWHUUXSWHQDEOH 5[IODJGHWHFWHGLQWHUUXSWHQDEOH .6&5,6&0,&52&21752//(5 +'/&&21752//(56 7DEOH+,17(15HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ >@ >@ %LW1DPH '7[12,( '3//20,( '3//70,( 'HVFULSWLRQ '0$7[QRWRZQHULQWHUUXSWHQDEOH '3//RQHFORFNPLVVLQJLQWHUUXSWHQDEOH '3//WZRFORFNVPLVVLQJLQWHUUXSWHQDEOH +'/&&21752//(56 .6&5,6&0,&52&21752//(5 ' 3 / / 7 0 , ( ' 3 / / 2 0 , ( ' 7 [ 1 2 , ( ' 7 [ 1 / , ( ' 7 [ ) ' , ( ' 5 [ 1 2 , ( ' 5 [ 1 / , ( ' 5 [ ) ' , ( 5 [ , ( 5 5 , ( ' 7 [ $ % 7 , ( 5 [ 0 2 9 , ( 5 [ 2 9 , ( 5 [ 1 2 , ( 5 [ & 5 & ( , ( 5 [ $ % 7 , ( 5 [ , ' / ( , ( 5 [ ) 9 , ( 5 [ 6 ' & ' , ( 5 [ ) ' , ( 5 [ ) $ , ( 7 [ 8 , ( 7 [ 6 & 7 6 , ( 7 [ ) $ , ( ( 7 [ ) & , ( >@5HVHUYHG >@7[IUDPHFRPSOHWHLQWHUUXSWHQDEOH 7[)&,( >@7[),)2DYDLODEOHWRZULWHLQWHUUXSW HQDEOH7[)$,( >@5HVHUYHG >@&76WUDQVLWLRQKDVRFFXUUHGLQWHUUXSW HQDEOH7[6&7,( >@7UDQVPLWXQGHUUXQKDVRFFXUUHG LQWHUUXSWHQDEOH7[8,( >@5[),)2DYDLODEOHWRUHDGLQWHUUXSW HQDEOH5[)$,( >@5HVHUYHG >@)ODJGHWHFWHGLQWHUUXSWHQDEOH 5[)',( >@5HVHUYHG >@'&'WUDQVLWLRQLQWHUUXSWHQDEOH 5[6'&',( >@9DOLGIUDPHLQWHUUXSWHQDEOH5[)9,( >@,GOHGHWHFWHGLQWHUUXSWHQDEOH 5[,'/(,( >@$ERUWGHWHFWHGLQWHUUXSWHQDEOH 5[$%7,( >@&5&HUURUIUDPHLQWHUUXSWHQDEOH 5[&5&(,( >@1RQRFWHWDOLJQHGIUDPHLQWHUUXSW HQDEOH5[12,( >@5[RYHUUXQLQWHUUXSWHQDEOH5[29,( >@5[PHPRU\RYHUIORZLQWHUUXSWHQDEOH 5[029,( >@5HVHUYHG >@'0$7[DERUWLQWHUUXSWHQDEOH '7[$%7,( >@5[LQWHUQDOHUURULQWHUUXSWHQDEOH 5[,(55,(1 >@'0$5[IUDPHGRQHHYHU\UHFHLYHGIUDPH LQWHUUXSWHQDEOH'5[)',( >@'0$5[QXOOOLVWLQWHUUXSWHQDEOH '5[1/,( >@'0$5[QRWRZQHULQWHUUXSW HQDEOH'5[12,( >@'0$7[IUDPHGRQHHYHU\UHFHLYHGIUDPH LQWHUUXSWHQDEOH'7[)',( >@'0$7[QXOOOLVWLQWHUUXSWHQDEOH '7[1/,( >@'0$7[QRWRZQHULQWHUUXSWHQDEOH '7[12,( >@'3//RQHPLVVLQJLQWHUUXSWHQDEOH '3//20,( >@'3//WZRPLVVLQJLQWHUUXSWHQDEOH '3//70,( )LJXUH+'/&,QWHUUXSW(QDEOH5HJLVWHU .6&5,6&0,&52&21752//(5 +'/&&21752//(56 +'/&7;),)2+7;),)2 7KH7[),)2FRQVLVWVRIHLJKWELWUHJLVWHUVWKDWDUHXVHGIRUEXIIHUVWRUDJHRIGDWDWREHWUDQVPLWWHG'DWDLV DOZD\VWUDQVIHUUHGIURPDIXOOUHJLVWHUWRDQHPSW\DGMDFHQWUHJLVWHU7KH7[),)2FDQEHDGGUHVVHGDWWZRGLIIHUHQW UHJLVWHUDGGUHVVHVWKHIUDPHFRQWLQXHDGGUHVVDQGWKHIUDPHWHUPLQDWHDGGUHVV (DFKUHJLVWHUKDVIRXUSRLQWHUVGDWDYDOLGSRLQWHUELWELWVODVWSRLQWHUELW1R&5&SRLQWHUELW3UHDPEOHSRLQWHU ELW7KHGDWDYDOLGSRLQWHUELWLQGLFDWHVZKHWKHUHDFKE\WHLVYDOLGRUQRW7KHODVWE\WHSRLQWHUELWLQGLFDWHVZKHWKHU WKHIUDPHWREHVHQWKDVWKHIUDPHODVWE\WHRUQRW7KH1R&5&SRLQWHUELWGHWHUPLQHVZKHWKHUWKH&5&GDWDLVWR EHDSSHQGHGRUQRWE\KDUGZDUH :KHQDYDOLGGDWDE\WHLVZULWWHQWRWKHIUDPHFRQWLQXHDGGUHVVWKHGDWDYDOLGSRLQWHULVVHWEXWWKHODVWE\WH SRLQWHULVQRWVHW:KHQDYDOLGGDWDE\WHLVZULWWHQWRWKHIUDPHWHUPLQDWHDGGUHVVWKHGDWDYDOLGSRLQWHUDQGODVW E\WHSRLQWHUDUHVHWWRJHWKHU7RUHVHWWKHVHSRLQWHUV\RXZULWHDWRHLWKHUWKH7[$%7ELWRUWKH7[56ELWLQWKH +&21UHJLVWHU ,Q'0$PRGHZKHQWKH'0$FRQWUROOHUZULWHVGDWDWRWKH+7[),)27[EXIIHUGHVFULSWRU%XIIHU/HQJWKILHOGYDOXH PXVWEHSUHVHW+RZHYHULIWKH/DVWELWLVVHWLQEXIIHUGHVFULSWRUWKHODVWE\WHSRLQWHULQ+7[),)2LVDOVRVHW7KLV PHDQVWKHODVWE\WHRIWKHIUDPHLVLQ+7[),)2,IWKHWUDQVPLWWHGIUDPHLVORQJHUWKDQWKH%XIIHU/HQJWKILHOGYDOXH WKHODVWE\WHSRLQWHUZLOOQRWEHVHWDQGWKHQH[WEXIIHUGHVFULSWRUKDYLQJWKHODVWE\WHSRLQWHUELWZLOOEHXVHG 7KHSRLQWHUVFRQWLQXHVKLIWLQJWKURXJKWKH),)2:KHQWKHWUDQVPLWWHUGHWHFWVDSRVLWLYHWUDQVLWLRQLQWKHGDWDYDOLG SRLQWHUDWWKHODVWORFDWLRQRIWKH),)2LWLQLWLDWHVDIUDPHZLWKDQRSHQLQJIODJ:KHQLWGHWHFWVDQHJDWLYHWUDQVLWLRQ LQWKHODVWE\WHSRLQWHUDWWKHODVWORFDWLRQRIWKH),)2LWFORVHVWKHIUDPHDSSHQGLQJWKH&5&DQGDFORVLQJIODJ IROORZV 7KHVWDWXVRIWKH7[),)2LVLQGLFDWHGE\WKHWUDQVPLWWHU),)2UHJLVWHUDYDLODEOH7[)$VWDWXVELW:KHQ7[)$ WKH7[),)2LVDYDLODEOHIRUORDGLQJGDWDDQGGDWDFDQEHORDGHGLQWRLW7KLVIXQFWLRQLVFRQWUROOHGE\WKH7[:' ELW7KH+7[),)2LVUHVHWE\ZULWLQJDWRWKH7[UHVHWRUWKH7[$%7ELWRUE\WKHQ5(6(7'XULQJDUHVHW RSHUDWLRQWKH7[)$VWDWXVELWLVVXSSUHVVHGDQGGDWDORDGLQJLVLQKLELWHG 7[),)2 ELW ELW ELW ELW 'DWD9DOLGELW /DVWELW 1R&5& 3UHDPEOH 7['DWD )LJXUH+'/&7[),)2)XQFWLRQ'LDJUDP +'/&&21752//(56 .6&5,6&0,&52&21752//(5 +'/&5;),)2+5;),)2 7KH5[),)2FRQVLVWVRIHLJKWELWUHJLVWHUVWKDWDUHXVHGIRUWKHEXIIHUVWRUDJHRIWKHGDWDUHFHLYHG'DWDE\WHV DUHDOZD\VWUDQVIHUUHGIURPDIXOOUHJLVWHUWRDQDGMDFHQWHPSW\UHJLVWHU(DFKUHJLVWHUKDVSRLQWHUELWVWKDWLQGLFDWH WKHIUDPHVWDWXV:KHQWKHVHSRLQWHUVDSSHDUDWWKHODVWZRUGRUZRUG),)2ORFDWLRQWKH\XSGDWHWKH/$67 ELWLQGLFDWLQJWKHODVWRIDIUDPHWKH29(5581ELWWKH&5&HUURUELWRU1RQRFWHWDOLJQHGELW 7KH+5;),)2GDWDDYDLODEOH5[)$VWDWXVELWVLQGLFDWHWKHFXUUHQWVWDWHRIWKH+5;),)2:KHQWKH+5;),)2 GDWDVWDWXVELWLVWKH+5;),)2LVUHDG\WREHUHDG7KH+5;),)2GDWDVWDWXVLVFRQWUROOHGE\WKHZRUGRU ZRUGWUDQVIHUVHOHFWLRQELW5[:':KHQDQRYHUUXQRFFXUVWKHRYHUUXQIUDPHRIWKH+5;),)2LVQRORQJHU YDOLG $QLQIUDPHDERUWRUD+LJKOHYHORQQ'&'LQSXWZLWKWKH$XWR(1ELWLQ+&21LVVHWWRWKHIUDPHLVFOHDUHGLQ WKH+5;),)27KHODVWE\WHRIWKHSUHYLRXVIUDPHZKLFKLVVHSDUDWHGE\WKHIUDPHERXQGDU\SRLQWHULVUHWDLQHG 'DWDLQ+5;),)2VKRXOGEHUHDGE\ZRUGVL]H 7KH+5;),)2LVFOHDUHGE\WKH5[UHVHWELWVHWWRDQDERUWVLJQDOUHFHLYHGRUQ5(6(7 5[),)2 ELW ELW ELW ELW 'DWD9DOLG /DVW 29 &5&( 12 5['DWD )LJXUH+'/&5[),)2)XQFWLRQ'LDJUDP .6&5,6&0,&52&21752//(5 +'/&&21752//(56 +'/&%5*7,0(&2167$175(*,67(56+%5*7& 7DEOH+%5*7&$DQG+%5*7&%5HJLVWHU 5HJLVWHUV +%5*7&$ +%5*7&% 2IIVHW$GGUHVV [F [F 5: 5: 5: 'HVFULSWLRQ +'/&%5*7LPH&RQVWDQW5HJLVWHU +'/&%5*7LPH&RQVWDQW5HJLVWHU 5HVHW9DOXH [ [ 7KH+'/&%5*WLPHFRQVWDQWUHJLVWHUYDOXHFDQEHFKDQJHGDWDQ\WLPHEXWWKHQHZYDOXHGRHVQRWWDNHHIIHFW XQWLOWKHQH[WWLPHWKHFRQVWDQWLVORDGHGLQWRWKHGRZQFRXQWHU1RDWWHPSWLVPDGHWRV\QFKURQL]HWKHORDGLQJRI WKHWLPHFRQVWDQWLQWR+%5*7&ZKLOHWKHFORFNLVGULYLQJWKHGRZQFRXQWHU)RUWKLVUHDVRQ\RXVKRXOGILUVWGLVDEOH WKHEDXGUDWHJHQHUDWRUEHIRUHORDGLQJWKHQHZWLPHFRQVWDQWLQWRWKH+%5*7&UHJLVWHU 7KHIRUPXODIRUGHWHUPLQLQJWKHDSSURSULDWHWLPHFRQVWDQWIRUDJLYHQEDXGUDWHLVVKRZQEHORZ7KHGHVLUHGUDWHLV VKRZQLQELWVSHUVHFRQG7KLVIRUPXODVKRZVKRZWKHFRXQWHUGHFUHPHQWVIURP1GRZQWR]HURSOXVRQHF\FOHVIRU UHORDGLQJWKHWLPHFRQVWDQW7KLVYDOXHLVWKHQIHGWRDWRJJOHIOLSIORSWRJHQHUDWHWKHVTXDUHZDYHRXWSXW %5*287 0&/.RU5[&&17&17RURUDFFRUGLQJWR&17YDOXHRIWKH+%5*7& &17 &17 &17 >@7LPHFRQVWDQWYDOXHIRU&17 GLYLGHE\ GLYLGHE\ GLYLGHE\ >@7LPHFRQVWDQWYDOXHIRU&17 GLYLGHE\ GLYLGHE\ >@7LPHFRQVWDQWYDOXHIRU&17 )LJXUH+'/&%5*7LPH&RQVWDQW5HJLVWHU +'/&&21752//(56 .6&5,6&0,&52&21752//(5 +'/&35($0%/(&2167$175(*,67(5+350% 7KH+350%UHJLVWHULVXVHGWRPHHWWKH'3//UHTXLUHPHQWVIRUSKDVHORFNLQJ7KHSUHDPEOHSDWWHUQLV WUDQVPLWWHGDVPDQ\7[SUHDPEOHOHQJWKELWYDOXHVLQ+02'(>@ZKHQWKH7[SUHDPEOHELW7[350%LVDQG WKHQWKH7[SUHDPEOHELWLVFOHDUHGDXWRPDWLFDOO\7KHRSHQLQJIODJIROORZVWKLVSUHDPEOHSDWWHUQDQGWKHGDWDZLOO EHWUDQVPLWWHG 7DEOH+350%$DQG+350%%5HJLVWHU 5HJLVWHUV +350%$ +350%% 2IIVHW$GGUHVV [ [ 5: 5: 5: 'HVFULSWLRQ +'/&3UHDPEOH&RQVWDQW5HJLVWHU +'/&3UHDPEOH&RQVWDQW5HJLVWHU 5HVHW9DOXH [ [ 3UHDPEOH3DWWHUQ >@3UHDPEOH3DWWHUQ )LJXUH+'/&3UHDPEOH&RQVWDQW5HJLVWHU 7KHUHIHUHQFHIRUWKHSUHDPEOHSDWWHUQRIHDFKGDWDPRGHLVDVIROORZV 7DEOH3UHDPEOH5HIHUHQFH3DWWHUQ 'DWD0RGH 15= 15=, )0 )0 0$1&+(67(5 3UHDPEOH3DWWHUQ $$ )) $$ .6&5,6&0,&52&21752//(5 +'/&&21752//(56 +'/&67$7,21$''5(665(*,67(56+6$'5$1'+0$6.5(*,67(5 (DFK+'/&FRQWUROOHUKDVILYHELWUHJLVWHUVIRUDGGUHVVUHFRJQLWLRQIRXUVWDWLRQDGGUHVVUHJLVWHUVDQGRQHPDVN UHJLVWHU*HQHUDOO\WKH+'/&FRQWUROOHUUHDGVWKHDGGUHVVRIWKHIUDPHIURPWKHUHFHLYHUWRFKHFNLWDJDLQVWWKH IRXUVWDWLRQDGGUHVVYDOXHVDQGWKHQPDVNVWKHUHVXOWZLWKWKHXVHUGHILQHG+0$6.UHJLVWHU$LQWKH+0$6. UHJLVWHUUHSUHVHQWVDELWSRVLWLRQIRUZKLFKDQDGGUHVVFRPSDULVLRQVKRXOGRFFXU$UHSUHVHQWVDPDVNHGELW SRVLWLRQ,I\RXFKHFNWKHDGGUHVVXSWRIRXUE\WHVWKH+0$6.UHJLVWHUYDOXHVKRXOGEH[IIIIIIII'HSHQGHQWRQWKH +0$6.UHJLVWHUYDOXHWKHIUDPHVDGGUHVVLVFRPSDUHG,IWKHDGGUHVVLVQRWPDWFKHGWKLVIUDPHLVGLVFDUGHG 7DEOH+6$'5DQG+0$6.5HJLVWHU 5HJLVWHUV +6$'5$ +6$'5$ +6$'5$ +6$'5$ +0$6.$ +6$'5% +6$'5% +6$'5% +6$'5% +0$6.% 2IIVHW$GGUHVV [ [ [F [ [ [ [ [F [ [ 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 5: 'HVFULSWLRQ +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&DGGUHVVPDVNUHJLVWHU +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&VWDWLRQDGGUHVV +'/&DGGUHVVPDVNUHJLVWHU 5HVHW9DO ; ; ; ; ; ; ; ; ; ; +0$6. +6$'5 +6$'5 +6$'5 +6$'5 [)))))))) [$%&'()*+ [)))))))) [$%&'()*+ [$%&'()*+ +0$6. +6$'5 +6$'5 +6$'5 +6$'5 [)) [;;;;;; [;;;;;; [;;;;;; [;;;;;; 1RWH5HFRJQL]HRQHELWDGGUHVVDQG WKHELWEURDGFDVWDGGUHVV 1RWH5HFRJQL]HDVLQJOHELWDGGUHVV )LJXUH$GGUHVV5HFRJQLWLRQ +'/&&21752//(56 .6&5,6&0,&52&21752//(5 ILUVWE\WH VHFRQGE\WH WKLUGE\WH IRXUWKE\WH 6WDWLRQDGGUHVVE\WHUHJLVWHUDQG0$6.UHJLVWHU >@)LUVWDGGUHVVE\WH >@6HFRQGDGGUHVVE\WH >@7KLUGDGGUHVVE\WH >@)RXUWKDGGUHVVE\WH )LJXUH+'/&6WDWLRQ$GGUHVVDQG+0$6.5HJLVWHU .6&5,6&0,&52&21752//(5 +'/&&21752//(56 '0$7;%8))(5'(6&5,372532,17(55(*,67(5 7KH'0$WUDQVPLWEXIIHUGHVFULSWRUSRLQWHUUHJLVWHUFRQWDLQVWKHDGGUHVVRIWKH7[EXIIHUGDWDSRLQWHURQWKHGDWDWR EHVHQW'XULQJD'0$RSHUDWLRQWKHEXIIHUGHVFULSWRUSRLQWHULVXSGDWHGE\WKHQH[WEXIIHUGDWDSRLQWHU 7DEOH'0$7[%XIIHU'HVFULSWRU3RLQWHU5HJLVWHUV 5HJLVWHUV +'0$7;375$ +'0$7;375% 2IIVHW$GGUHVV [ [ 5: 5: 5: 'HVFULSWLRQ '0$7[%XIIHU'HVFULSWRU3RLQWHU '0$7[%XIIHU'HVFULSWRU3RLQWHU 5HVHW9DOXH [)))))))) [)))))))) '0$7[%XIIHU'HVFULSWRU3RLQWHU >@'0$7[%XIIHU'HVFULSWRU3RLQWHU )LJXUH'0$7[%XIIHU'HVFULSWRU3RLQWHU +'/&&21752//(56 .6&5,6&0,&52&21752//(5 '0$5;%8))(5'(6&5,372532,17(55(*,67(5 7KH'0$UHFHLYHEXIIHUGHVFULSWRUSRLQWHUUHJLVWHUFRQWDLQVWKHDGGUHVVRIWKH5[EXIIHUGDWDSRLQWHURQWKHGDWDWR EHUHFHLYHG'XULQJD'0$RSHUDWLRQWKHEXIIHUGHVFULSWRUSRLQWHULVXSGDWHGE\WKHQH[WEXIIHUGDWDSRLQWHU 7DEOH'0$5[%XIIHU'HVFULSWRU3RLQWHU5HJLVWHUV 5HJLVWHUV +'0$5;375$ +'0$5;375% 2IIVHW$GGUHVV [F [F 5: 5: 5: 'HVFULSWLRQ '0$5[%XIIHU'HVFULSWRU3RLQWHU '0$5[%XIIHU'HVFULSWRU3RLQWHU 5HVHW9DOXH [)))))))) [)))))))) '0$5[%XIIHU'HVFULSWRU3RLQWHU >@'0$5[%XIIHU'HVFULSWRU3RLQWHU )LJXUH'0$5[%XIIHU'HVFULSWRU3RLQWHU .6&5,6&0,&52&21752//(5 +'/&&21752//(56 0$;,080)5$0(/(1*7+5(*,67(5 7KH+'/&FRQWUROOHUFKHFNVWKHOHQJWKRIDQLQFRPLQJIUDPHDJDLQVWWKHXVHUGHILQHGYDOXHLQ'0$PRGH,IWKH IUDPHUHFHLYHGH[FHHGVWKLVUHJLVWHUYDOXHWKHIUDPHLVGLVFDUGHGDQG)/9)UDPH/HQJWK9LRODWHGELWLVVHWLQWKH EXIIHUGHVFULSWRUEHORQJLQJWRWKDWIUDPH 7DEOH+'0$7;&17DQG+'0$5;&175HJLVWHUV 5HJLVWHUV +0)/5$ +0)/5% 2IIVHW$GGUHVV [ [ 5: 5: 5: 'HVFULSWLRQ 0D[LPXP)UDPH/HQJWK 0D[LPXP)UDPH/HQJWK 5HVHW9DOXH [;;;; [;;;; 0D[LPXP)UDPH/HQJWK >@0D[LPXP)UDPH/HQJWK )LJXUH0D[LPXP)UDPH/HQJWK5HJLVWHU +'/&&21752//(56 .6&5,6&0,&52&21752//(5 5(&(,9(%8))(56,=(5(*,67(5 7KH5[EXIIHUVL]HUHJLVWHUFRQWDLQVWKHELWXVHUGHILQHGYDOXH7KLVXVHUGHILQHGFRXQWYDOXHGHWHUPLQHVWKH EXIIHUVL]HIRURQH%XIIHU'HVFULSWRU,ILQFRPLQJ+'/&IUDPHLVORQJHUWKDQWKH5[EXIIHUVL]HUHJLVWHUYDOXHWKH QH[WEXIIHUGHVFULSWRUKDYLQJWKH5[EXIIHUVL]HYDOXHZLOOEHXVHG 7DEOH'0$5[%XIIHU6L]H5HJLVWHU 5HJLVWHUV +5%65$ +5%65% 2IIVHW$GGUHVV [ [ 5: 5: 5: 'HVFULSWLRQ 5HFHLYH%XIIHU6L]H5HJLVWHU 5HFHLYH%XIIHU6L]H5HJLVWHU 5HVHW9DOXH [;;;; [;;;; 5HFHLYH%XIIHU6L]H >@5HFHLYH%XIIHU6L]H5HJLVWHU )LJXUH'0$5HFHLYH%XIIHU6L]H5HJLVWHU .6&5,6&0,&52&21752//(5 '0$&21752//(5 '0$&21752//(5 7KH.6&KDVDWZRFKDQQHOJHQHUDO'0$FRQWUROOHUFDOOHGWKH*'0$7KHWZRFKDQQHO*'0$SHUIRUPV WKHIROORZLQJGDWDWUDQVIHUVZLWKRXW&38LQWHUYHQWLRQ 0HPRU\WRPHPRU\PHPRU\WRIURPPHPRU\ 8$57WRPHPRU\VHULDOSRUWWRIURPPHPRU\ 7KHRQFKLS*'0$FDQEHVWDUWHGE\VRIWZDUHDQGRUE\DQH[WHUQDO'0$UHTXHVWQ;'5(46RIWZDUHFDQDOVR EHXVHGWRUHVWDUWD*'0$RSHUDWLRQDIWHULWKDVEHHQVWRSSHG 7KH&38FDQUHFRJQL]HZKHQD*'0$RSHUDWLRQKDVEHHQFRPSOHWHGE\VRIWZDUHSROOLQJDQGRUZKHQLWUHFHLYHV DQDSSURSULDWHLQWHUQDOO\JHQHUDWHG*'0$LQWHUUXSW7KH.6&*'0$FRQWUROOHUFDQLQFUHPHQWRU GHFUHPHQWVRXUFHRUGHVWLQDWLRQDGGUHVVHVDQGFRQGXFWELWE\WHELWKDOIZRUGRUELWZRUGGDWD WUDQVIHUV 6<67(0%86 0RGH6HOHFWLRQ Q;'5(4 8$57 8$57 *'0$&KDQQHO Q'5(4 Q'$&. *'0$ 3RUW'DWD ,23&21>@ *'0$&KDQQHO Q'5(4 Q'$&. Q;'5(4 0RGH6HOHFWLRQ *'0$ ,23&21>@ 3RUW'DWD Q;'$&. Q;'$&. )LJXUH*'0$&RQWUROOHU%ORFN'LDJUDP '0$&21752//(5 .6&5,6&0,&52&21752//(5 *'0$63(&,$/5(*,67(56 7DEOH*'0$6SHFLDO5HJLVWHUV2YHUYLHZ 5HJLVWHU *'0$&21 *'0$&21 *'0$65& *'0$'67 *'0$65& *'0$'67 *'0$&17 *'0$&17 2IIVHW$GGUHVV [% [& [% [% [& [& [%& [&& 5: 5: 5: 5: 5: 5: 5: 5: 5: 'HVFULSWLRQ *'0$FRQWUROOHUFKDQQHOFRQWUROUHJLVWHU *'0$FRQWUROOHUFKDQQHOFRQWUROUHJLVWHU *'0$FKDQQHOVRXUFHDGGUHVVUHJLVWHU *'0$FKDQQHOGHVWLQDWLRQDGGUHVVUHJLVWHU *'0$FKDQQHOVRXUFHDGGUHVVUHJLVWHU *'0$FKDQQHOGHVWLQDWLRQDGGUHVVUHJLVWHU *'0$FKDQQHOWUDQVIHUFRXQWUHJLVWHU *'0$FKDQQHOWUDQVIHUFRXQWUHJLVWHU 5HVHW9DOXH [ [ 8QGHILQHG 8QGHILQHG 8QGHILQHG 8QGHILQHG 8QGHILQHG 8QGHILQHG *'0$&21752/5(*,67(56 7DEOH*'0$&21DQG*'0$&215HJLVWHUV 5HJLVWHU *'0$&21 *'0$&21 2IIVHW$GGUHVV [% [& 5: 5: 5: 'HVFULSWLRQ *'0$FRQWUROOHUFKDQQHOFRQWUROUHJLVWHU *'0$FRQWUROOHUFKDQQHOFRQWUROUHJLVWHU 5HVHW9DOXH [ [ 7DEOH*'0$&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 5XQHQDEOHGLVDEOH 'HVFULSWLRQ 6HWWLQJWKLVELWWRVWDUWVD'0$RSHUDWLRQ7RVWRS'0$ \RXPXVWFOHDUWKLVELWWR<RXFDQXVHWKH*0$UXQELW FRQWURODGGUHVV*'0$&21RIIVHWDGGUHVV[WR PDQLSXODWHWKLVELW%\XVLQJWKHUXQELWFRQWURODGGUHVV RWKHU*'0$FRQWUROUHJLVWHUYDOXHVDUHQRWDIIHFWHG :KHQ'0$VWDUWVWKLVUHDGRQO\VWDWXVELWLVDXWRPDWLFDOO\ VHWWR:KHQLWLV'0$LVLGOH )RXUVRXUFHVFDQLQLWLDWHD'0$RSHUDWLRQVRIWZDUH PHPRU\WRPHPRU\DQH[WHUQDO'0$UHTXHVW Q;'5(4WKH8$57EORFNDQGWKH8$57EORFN 7KHPRGHVHOHFWLRQVHWWLQJGHWHUPLQHVZKLFKVRXUFHFDQ LQLWLDWHD'0$RSHUDWLRQDWDQ\JLYHQWLPH 7KLVELWFRQWUROVZKHWKHUWKHGHVWLQDWLRQDGGUHVVZLOOEH GHFUHPHQWHGRULQFUHPHQWHGGXULQJD'0$ RSHUDWLRQ >@ >@ %XV\VWDWXV *'0$PRGHVHOHFWLRQ >@ 'HVWLQDWLRQDGGUHVVGLUHFWLRQ .6&5,6&0,&52&21752//(5 '0$&21752//(5 7DEOH*'0$&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 6RXUFHDGGUHVVGLUHFWLRQ 'HVFULSWLRQ 7KLVELWFRQWUROVZKHWKHUWKHVRXUFHDGGUHVVZLOOEH GHFUHPHQWHGRULQFUHPHQWHGGXULQJD'0$ RSHUDWLRQ 7KLVELWGHWHUPLQHVZKHWKHURUQRWWKHGHVWLQDWLRQDGGUHVV ZLOOEHFKDQJHGGXULQJD'0$RSHUDWLRQ<RXXVHWKLV IHDWXUHZKHQWUDQVIHUULQJGDWDIURPPXOWLSOHVRXUFHVWRD VLQJOHGHVWLQDWLRQ 7KLVELWGHWHUPLQHVZKHWKHURUQRWWKHVRXUFHDGGUHVVZLOO EHFKDQJHGGXULQJD'0$RSHUDWLRQ<RXXVHWKLVIHDWXUH ZKHQWUDQVIHUULQJGDWDIURPDVLQJOHVRXUFHWRPXOWLSOH GHVWLQDWLRQV 7RVWDUWVWRSD'0$RSHUDWLRQ\RXVHWFOHDUWKHUXQHQDEOH ELW,IWKH6WRSLQWHUUXSWHQDEOHELWLVZKHQ'0$VWDUWVD 6WRSLQWHUUXSWLVJHQHUDWHGZKHQ'0$RSHUDWLRQVWRSV,I WKLVELWLVWKH6WRSLQWHUUXSWLVQRWJHQHUDWHG ,IWKLVELWLVVHWWRRQH*'0$RSHUDWHVXQGHUGDWDEXUVW PRGH8QGHUWKHGDWDEXUVWPRGHFRQVHFXWLYHVRXUFH DGGUHVVHVDUHUHDGDQGWKHQDUHZULWWHQWRWKHFRQVHFXWLYH GHVWLQDWLRQDGGUHVVHV,IGDWDEXUVWPRGHLVVHWWRRQH WUDQVIHUFRXQWUHJLVWHUVKRXOGEHVHWFDUHIXOO\EHFDXVHWKH GDWDEXUVWPRYHLVH[HFXWHGGXULQJGHFUHDVLQJRIWKH WUDQVIHUFRXQW7KHGDWDEXUVWPRGHFDQEHXVHGRQO\ ZKHQ*0'$PRGHLVVRIWZDUHRUH[WHUQDO'0$UHTXHVW PRGH 7KLVELWLVXVHGWRVSHFLI\WKHGLUHFWLRQRID'0$RSHUDWLRQ ZKHQWKHPRGHELWV>@DUHVHWWR8$57IURPWR PHPRU\RU8$57IURPWRPHPRU\,IWKLVELWLV '0$RSHUDWHVLQWKHPHPRU\WRSHULSKHUDOGLUHFWLRQHJ WRWKHSDUDOOHOSRUWRU8$57:KHQLWLV'0$RSHUDWHV LQWKHSHULSKHUDOWRPHPRU\GLUHFWLRQ 7KLVELWGHWHUPLQHVWKHQXPEHURIH[WHUQDO'0$UHTXHVWV Q;'5(4VWKDWDUHUHTXLUHGIRUD'0$RSHUDWLRQ,Q 6LQJOHPRGHZKHQ>@ WKH.6&UHTXLUHVDQ H[WHUQDO'0$UHTXHVWIRUHYHU\'0$RSHUDWLRQ ,Q%ORFNPRGHZKHQ>@ WKH.6&UHTXLUHV RQO\RQHH[WHUQDO'0$UHTXHVWGXULQJWKHHQWLUH'0$ RSHUDWLRQ$QHQWLUH'0$RSHUDWLRQLVGHILQHGDVWKH RSHUDWLRQRI'0$XQWLOWKHFRXQWHUYDOXHLV]HUR 127(<RXVKRXOGQRWXVH%ORFNPRGHWRJHWKHUZLWK 'HPDQGPRGHRU6LQJOHPRGHLQFRQMXQFWLRQZLWK &RQWLQXRXVPRGH >@ 'HVWLQDWLRQDGGUHVVIL[ >@ 6RXUFHDGGUHVVIL[ >@ 6WRSLQWHUUXSWHQDEOH >@ )RXUGDWDEXUVWHQDEOH >@ 3HULSKHUDOGLUHFWLRQ >@ 6LQJOH%ORFNPRGH '0$&21752//(5 .6&5,6&0,&52&21752//(5 7DEOH*'0$&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 7UDQVIHUZLGWK 'HVFULSWLRQ 7KHVHELWVGHWHUPLQHWKHWUDQVIHUGDWDZLGWKWREHRQHE\WH RQHKDOIZRUGRURQHZRUG,I\RXVHOHFWDE\WHWUDQVIHU RSHUDWLRQWKHVRXUFHGHVWLQDWLRQDGGUHVVZLOOEH LQFUHPHQWHGRUGHFUHPHQWHGE\RQHZLWKHDFKWUDQVIHU (DFKKDOIZRUGWUDQVIHULQFUHPHQWVRUGHFUHPHQWVWKH DGGUHVVE\WZRDQGHDFKZRUGWUDQVIHUE\IRXU 7KLVELWOHWVWKH'0$FRQWUROOHUKROGWKHV\VWHPEXVXQWLO WKH'0$WUDQVIHUFRXQWYDOXHLV]HUR<RXPXVWWKHUHIRUH PDQLSXODWHWKLVELWFDUHIXOO\VRWKDW'0$WUDQVIHU RSHUDWLRQVGRQRWH[FHHGDDFFHSWDEOHWLPHLQWHUYDODVIRU H[DPSOHLQD'5$0UHIUHVKRSHUDWLRQ 127(<RXFDQXVH&RQWLQXRXVPRGHWRJHWKHUZLWKD VRIWZDUHUHTXHVWPRGH 6HWWLQJWKLVELWVSHHGVXSH[WHUQDO'0$RSHUDWLRQV:KHQ >@ WKH'0$WUDQVIHUVGDWDZKHQWKHH[WHUQDO'0$ UHTXHVWVLJQDOQ;'5(4LVDFWLYH7KHDPRXQWRIGDWD WUDQVIHUUHGGHSHQGVRQKRZORQJQ;'5(4LVDFWLYH:KHQ Q;'5(4LVDFWLYHDQG'0$JHWVWKHEXVLQ'HPDQGPRGH '0$KROGVWKHV\VWHPEXVXQWLOWKHQ;'5(4VLJQDO EHFRPHVQRQDFWLYH7KHUHIRUHWKHSHULRGRIWKHDFWLYH Q;'5(4VLJQDOVKRXOGEHFDUHIXOO\WLPHGVRWKDWWKHHQWLUH RSHUDWLRQGRHVQRWH[FHHGDQDFFHSWDEOHLQWHUYDODVIRU H[DPSOHLQD'5$0UHIUHVKRSHUDWLRQ 127(,Q'HPDQGPRGH\RXPXVWFOHDUWKH6LQJOH%ORFN DQG&RQWLQXRXVPRGHFRQWUROELWVWR >@ &RQWLQXRXVPRGH >@ 'HPDQGPRGH 127( 7RHQVXUHWKHUHOLDELOLW\RI'0$RSHUDWLRQVWKH*'0$FRQWUROUHJLVWHUELWVPXVWEHFRQILJXUHGLQGHSHQGHQWO\DQG FDUHIXOO\ .6&5,6&0,&52&21752//(5 '0$&21752//(5 ' & 0 1 7 : 6 7 ) 6 6 ' 6 ' % ' % , ) ) $ $ 0 2 ' ( % 5 6 ( >@5XQHQDEOH5( 'LVDEOH'0$RSHUDWLRQ (QDEOH'0$RSHUDWLRQ '0$LVDFWLYH >@%XV\VWDWXV%6 '0$LVLGOH >@0RGHVHOHFWLRQ02'( 6RIWZDUHPRGHPHPRU\WRPHPRU\ ([WHUQDO(;7'5(4PRGHIRUH[WHUQDOGHYLFHV 8$57EORFN 8$57EORFN >@'HVWLQDWLRQDGGUHVVGLUHFWLRQ'$ >@6RXUFHDGGUHVVGLUHFWLRQ6$ ,QFUHDVHVRXUFHDGGUHVV ,QFUHDVHGHVWLQDWLRQDGGUHVV 'HFUHDVHGHVWLQDWLRQDGGUHVV 'HFUHDVHVRXUFHDGGUHVV >@'HVWLQDWLRQDGGUHVVIL[') ,QFUHDVHGHFUHDVHGHVWLQDWLRQDGGUHVV 'RQRWFK DQJHGHVWLQDWLRQDGGUHVVIL[ >@6RXUFHDGGUHVVIL[6) ,QFUHDVHGHFUHDVHVRXUFHDGGUHVV 'RQRWFKDQJHVRXUFHDGGUHVVIL[ >@6WRSLQWHUUXSWHQDEOH6, 'RQRWJHQHUDWHD6WRSLQWHUUXSWZKHQ'0$VWRSV *HQHUDWHD6WRSLQWHUUXSWZKHQ'0$VWRSV >@)RXUGDWDEXUVWHQDEOH)% 'LVDEOHGDWDEXUVWPRGH (QDEOHGDWDEXUVWPRGH >@7UDQVIHUGLUHFWLRQIRU8$578$57RQO\7' 8$578$57WRPHPRU\ 0HPRU\WR8$578$57 >@6LQJOHEORFNPRGH6% 2QHQ;'5(4LQLWLDWHVDVLQJOH'0$RSHUDWLRQ 2QHQ;'5(4LQLWLDWHVDZKROH'0$RSHUDWLRQ >@7UDQVIHUZLGWK7: %\WHELWV :RUGELWV +DOIZRUGELWV 1RXVH >@&RQWLQXRXVPRGH&1 1RUPDORSHUDWLRQ +ROGV\VWHPEXVXQWLOWKHZKROH'0$RSHUDWLRQVWRSV >@'HPDQGPRGH'0 1RUPDOH[WHUQDO'0$PRGH 'HPDQGPRGH )LJXUH*'0$&RQWURO5HJLVWHU '0$&21752//(5 .6&5,6&0,&52&21752//(5 *'0$6285&('(67,1$7,21$''5(665(*,67(56 7KH*'0$VRXUFHGHVWLQDWLRQDGGUHVVUHJLVWHUVFRQWDLQWKHELWVRXUFHGHVWLQDWLRQDGGUHVVHVIRU*'0$ FKDQQHOVDQG'HSHQGLQJRQWKHVHWWLQJV\RXPDNHWRWKH*'0$FRQWUROUHJLVWHU*'0$&21WKHVRXUFHRU GHVWLQDWLRQDGGUHVVHVZLOOHLWKHUUHPDLQWKHVDPHRUWKH\ZLOOEHLQFUHPHQWHGRUGHFUHPHQWHG 7DEOH*'0$65&DQG*'0$'675HJLVWHUV 5HJLVWHU *'0$65& *'0$'67 *'0$65& *'0$'67 2IIVHW$GGUHVV [% [% [& [& 5: 5: 5: 5: 5: 'HVFULSWLRQ *'0$FKDQQHOVRXUFHDGGUHVVUHJLVWHU *'0$FKDQQHOGHVWLQDWLRQDGGUHVVUHJLVWHU *'0$FKDQQHOVRXUFHDGGUHVVUHJLVWHU *'0$FKDQQHOGHVWLQDWLRQDGGUHVVUHJLVWHU 5HVHW9DOXH 8QGHILQHG 8QGHILQHG 8QGHILQHG 8QGHILQHG 6RXUFH'HVWLQDWLRQ$GGUHVV >@6RXUFHGHVWLQDWLRQDGGUHVV )LJXUH*'0$6RXUFH'HVWLQDWLRQ$GGUHVV5HJLVWHU .6&5,6&0,&52&21752//(5 '0$&21752//(5 '0$75$16)(5&28175(*,67(56 7KH'0$WUDQVIHUFRXQWUHJLVWHUVFRQWDLQWKHELWFXUUHQWFRXQWYDOXHRIWKHQXPEHURI'0$WUDQVIHUVFRPSOHWHG IRU*'0$FKDQQHOVDQG 7KHFRXQWYDOXHLVDOZD\VGHFUHPHQWHGE\RQHIRUHDFKFRPSOHWHG'0$RSHUDWLRQUHJDUGOHVVRIWKH*'0$GDWD WUDQVIHUZLGWKRUIRXUGDWDEXUVWPRGH 127( $WWKHGDWDEXUVWPRGHDFWXDOWUDQVIHUGDWDVL]HZLOOEH7UDQVIHU&RXQW[ 7DEOH*'0$&175HJLVWHUV 5HJLVWHU *'0$&17 *'0$&17 2IIVHW$GGUHVV [%& [&& 5: 5: 5: 'HVFULSWLRQ *'0$FKDQQHOWUDQVIHUFRXQWUHJLVWHU *'0$FKDQQHOWUDQVIHUFRXQWUHJLVWHU 5HVHW9DOXH 8QGHILQHG 8QGHILQHG 7UDQVIHU&RXQW >@7UDQVIHUFRXQW )LJXUH'0$7UDQVIHU&RXQW5HJLVWHU '0$&21752//(5 .6&5,6&0,&52&21752//(5 *'0$)81&7,21'(6&5,37,21 7KHIROORZLQJVHFWLRQVSURYLGHDIXQFWLRQDOGHVFULSWLRQRIWKH*'0$FRQWUROOHURSHUDWLRQV *'0$75$16)(56 7KH*'0$WUDQVIHUVGDWDGLUHFWO\EHWZHHQDUHTXHVWHUDQGDWDUJHW7KHUHTXHVWHUDQGWDUJHWDUHPHPRU\8$57 RUH[WHUQDOGHYLFHV$QH[WHUQDOGHYLFHUHTXHVWV*'0$VHUYLFHE\DFWLYDWLQJQ;'5(4VLJQDO$FKDQQHOLV SURJUDPPHGE\ZULWLQJWRUHJLVWHUVZKLFKFRQWDLQUHTXHVWHUDGGUHVVWDUJHWDGGUHVVWKHDPRXQWRIGDWDDQGRWKHU FRQWUROFRQWHQWV8$57H[WHUQDO,2RU6RIWZDUHPHPRU\FDQUHTXHVW*'0$VHUYLFH8$57LVLQWHUQDOO\ FRQQHFWHGWRWKH*'0$ 67$57,1*(1',1**'0$75$16)(56 *'0$VWDUWVWRWUDQVIHUGDWDDIWHUWKH*'0$UHFHLYHVVHUYLFHUHTXHVWIURPQ;'5(4VLJQDO8$57RU6RIWZDUH :KHQWKHHQWLUHEXIIHURIGDWDKDVEHHQWUDQVIHUUHGWKH*'0$EHFRPHVLGOH,I\RXZDQWWRSUHIRUPDQRWKHUEXIIHU WUDQVIHUWKH*'0$PXVWEHUHSURJUDPPHG$OWKRXJKWKHVDPHEXIIHUWUDQVIHUZLLEHSUHIRUPHGDJDLQWKH*'0$ PXVWEHUHSURJUDPPHG '$7$75$16)(502'(6 6LQJOH0RGH $*'0$UHTXHVWQ;'5(4RUDQLQWHUQDOUHTXHVWFDXVHVRQHE\WHRQHKDOIZRUGRURQHZRUGWREHWUDQVPLWWHGLI GDWDEXUVWPRGHLVGLVDEOHVWDWHRUIRXUWLPHVRIWUDQVIHUZLGWKLIGDWDEXUVWPRGHLVHQDEOHVWDWH6LQJOHPRGH UHTXLUHVD*'0$UHTXHVWIRUHDFKGDWDWUDQVIHU7KHQ;'5(4VLJQDOFDQEHGHDVVHUWHGDIWHUFKHFNLQJWKDW Q;'$&.KDVEHHQDVVHUWHG Q;'5(4 Q;'$&. 5':5&\FOH )LJXUH([WHUQDO'0$5HTXHVWV6LQJOH0RGH .6&5,6&0,&52&21752//(5 '0$&21752//(5 %ORFN0RGH 7KHDVVHUWLRQRIRQO\RQH*'0$UHTXHVWQ;'5(4RUDQLQWHUQDOUHTXHVWFDXVHVDOORIWKHGDWDDVVSHFLILHGE\ WKHFRQWUROUHJLVWHUVHWWLQJVWREHWUDQVPLWWHGLQDVLQJOHRSHUDWLRQ7KH*'0$WUDQVIHULVFRPSOHWHGZKHQWKH WUDQVIHUFRXQWHUYDOXHUHDFKHV]HUR7KHQ;'5(4VLJQDOFDQEHGHDVVHUWHGDIWHUFKHFNLQJWKDWQ;'$&.KDV EHHQDVVHUWHG Q;'5(4 Q;'$&. 5':5&\FOH )LJXUH([WHUQDO'0$5HTXHVWV%ORFN0RGH '0$&21752//(5 .6&5,6&0,&52&21752//(5 'HPDQG0RGH ,Q'HPDQGPRGHWKH*'0$FRQWLQXHVWUDQVIHUULQJGDWDDVORQJDVWKH*'0$UHTXHVWLQSXWQ;'5(4LVKHOG DFWLYH Q;'5(4 Q;'$&. 5':5&\FOH )LJXUH([WHUQDO'0$5HTXHVWV'HPDQG0RGH '0$75$16)(57,0,1*'$7$ )LJXUHSURYLGHVGHWDLOHGWLPLQJGDWDIRU*'0$GDWDWUDQVIHUVWKDWDUHWULJJHUHGE\H[WHUQDO'0$UHTXHVWV 3OHDVHQRWHWKDWUHDGZULWHWLPLQJGHSHQGVRQZKLFKPHPRU\EDQNVDUHVHOHFWHG7RDFFHVV520EDQNVZKLFKLV LQPXOWLSOH[LQJEXVPRGHE\GDWDEXUVWPRGHUHIHUWRFKDSWHUSDJHIRUUHDGZULWHWLPLQJRI520EDQN ;&/. W;'5V W;'5K Q;'5(4 W;'$I 0LQF\FOHV W;'$U Q;'$&. ZRUVW W;'5V W;'5K W;'$I VHWXSWLPH KROGWLPH GHOD\ IDOOLQJ GHOD\ ULVLQJ QVHF EHVW W;'$U )LJXUH([WHUQDO'0$5HTXHVWV'HWDLOHG7LPLQJ .6&5,6&0,&52&21752//(5 8$57 6(5,$/,28$57 7KH.6&8$578QLYHUVDO$V\QFKURQRXV5HFHLYHU7UDQVPLWWHUXQLWSURYLGHVWZRLQGHSHQGHQW DV\QFKURQRXVVHULDO,26,2SRUWV(DFKSRUWFDQRSHUDWHLQLQWHUUXSWEDVHGRU'0$EDVHGPRGH7KDWLVWKH 8$57FDQJHQHUDWHLQWHUQDOLQWHUUXSWVRU'0$UHTXHVWVWRWUDQVIHUGDWDEHWZHHQWKH&38DQGWKHVHULDO,2SRUWV 7KHPRVWLPSRUWDQWIHDWXUHVRIWKH.6&8$57LQFOXGH 3URJUDPPDEOHEDXGUDWHV ,QIUDUHG,5WUDQVPLWUHFHLYH ,QVHUWLRQRIRQHRUWZR6WRSELWVSHUIUDPH 6HOHFWDEOHELWELWELWRUELWGDWDWUDQVIHUV 3DULW\FKHFNLQJ (DFK6,2XQLWKDVDEDXGUDWHJHQHUDWRUWUDQVPLWWHUUHFHLYHUDQGDFRQWUROXQLWDVVKRZQLQ)LJXUH7KH EDXGUDWHJHQHUDWRUFDQEHGULYHQE\WKHLQWHUQDOV\VWHPFORFN0&/.RUE\WKHH[WHUQDOFORFN8&/.7KH WUDQVPLWWHUDQGUHFHLYHUEORFNVKDYHLQGHSHQGHQWGDWDEXIIHUUHJLVWHUVDQGGDWDVKLIWHUV 7UDQVPLWGDWDLVZULWWHQILUVWWRWKHWUDQVPLWEXIIHUUHJLVWHU)URPWKHUHLWLVFRSLHGWRWKHWUDQVPLWVKLIWHUDQGWKHQ VKLIWHGRXWE\WKHWUDQVPLWGDWDSLQ8$7;'Q5HFHLYHGDWDLVVKLIWHGLQE\WKHUHFHLYHGDWDSLQ8$5;'Q,WLVWKHQ FRSLHGIURPWKHVKLIWHUWRWKHUHFHLYHEXIIHUUHJLVWHUZKHQRQHGDWDE\WHKDVEHHQUHFHLYHG 7KH6,2FRQWUROXQLWVSURYLGHVRIWZDUHFRQWUROVIRUPRGHVHOHFWLRQDQGIRUVWDWXVDQGLQWHUUXSWJHQHUDWLRQ 8$57 .6&5,6&0,&52&21752//(5 75$160,7%8))(55(*,67(5 87;%8)Q %$8'5$7(',9,625 87;%8)Q %$8'5$7(*(1(5$725 75$160,76+,)75(*,67(5 ,57[ (1&2'(5 8$7['Q 6 < 6 7 ( 0 % 8 6 /,1(&21752/5(*,67(5 8/&21Q 8$57&21752/5(*,67(5 8&21Q 8$5767$7865(*,67(5 867$7Q Q8$'75Q Q8$'65Q 5(&(,9(%8))(55(*,67(5 85;%8)Q 8$5['Q 5(&(,9(6+,)75(*,67(5 ,55[ '(&2'(5 )LJXUH6HULDO,2%ORFN'LDJUDP .6&5,6&0,&52&21752//(5 8$57 8$5763(&,$/5(*,67(56 7DEOH8$576SHFLDO5HJLVWHUV2YHUYLHZ 5HJLVWHU 8/&21 8/&21 8&21 8&21 867$7 867$7 87;%8) 87;%8) 85;%8) 85;%8) 8%5',9 8%5',9 %5'&17 %5'&17 %5'&/. %5'&/. 2IIVHW$GGUHVV [' [( [' [( [' [( ['& [(& [' [( [' [( [' [( ['& [(& 5: 5: 5: 5: 5: 5 5 : : 5 5 5: 5: : : : : 'HVFULSWLRQ 8$57OLQHFRQWUROUHJLVWHU 8$57OLQHFRQWUROUHJLVWHU 8$57FRQWUROUHJLVWHU 8$57FRQWUROUHJLVWHU 8$57VWDWXVUHJLVWHU 8$57VWDWXVUHJLVWHU 8$57WUDQVPLWEXIIHUUHJLVWHU 8$57WUDQVPLWEXIIHUUHJLVWHU 8$57UHFHLYHEXIIHUUHJLVWHU 8$57UHFHLYHEXIIHUUHJLVWHU 8$57EDXGUDWHGLYLVRUUHJLVWHU 8$57EDXGUDWHGLYLVRUUHJLVWHU 8$57EDXGUDWHFRXQWUHJLVWHU 8$57EDXGUDWHFRXQWUHJLVWHU 8$57EDXGUDWHFORFNPRQLWRU 8$57EDXGUDWHFORFNPRQLWRU 5HVHW9DOXH [ [ [ [ [& [& [;; [;; [;; [;; [ [ [ [ [ [ 8$57 .6&5,6&0,&52&21752//(5 8$57/,1(&21752/5(*,67(56 7DEOH8/&21DQG8/&215HJLVWHUV 5HJLVWHU 8/&21 8/&21 2IIVHW$GGUHVV [' [( 5: 5: 5: 'HVFULSWLRQ 8$57OLQHFRQWUROUHJLVWHU 8$57OLQHFRQWUROUHJLVWHU 5HVHW9DOXH [ [ 7DEOH8$57/LQH&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH :RUGOHQJWK:/ 'HVFULSWLRQ 7KLVWZRELWZRUGOHQJWKYDOXHLQGLFDWHVWKHQXPEHURIGDWD ELWVWREHWUDQVPLWWHGRUUHFHLYHGSHUIUDPH ELWV ELWV ELWVDQG ELWV 7KLVELWVSHFLILHVKRZPDQ\6WRSELWVDUHXVHGWRVLJQDO HQGRIIUDPH(2) RQH6WRSELWSHUIUDPHDQG WZR6WRSELWVSHUIUDPH 7KHELWSDULW\PRGHYDOXHVSHFLILHVKRZSDULW\JHQHUDWLRQ DQGFKHFNLQJDUHWREHSHUIRUPHGGXULQJ8$57WUDQVPLW DQGUHFHLYHRSHUDWLRQV[[ QRSDULW\ RGGSDULW\ HYHQSDULW\ SDULW\LVIRUFHGFKHFNHGDVD DQG SDULW\IRUFHGFKHFNHGDVD 7KLVVHOHFWLRQELWVSHFLILHVWKHFORFNVRXUFH ,QWHUQDO0&/. ([WHUQDO8&/. 7KH.6&8$57EORFNVXSSRUWVLQIUDUHG,5 WUDQVPLWDQGUHFHLYHRSHUDWLRQV,Q,5PRGHWKHWUDQVPLW SHULRGLVSXOVHGDWDUDWHRIWKDWRIWKHQRUPDOVHULDO WUDQVPLWUDWHZKHQWKHWUDQVPLWGDWDYDOXHLQWKH87;%8) UHJLVWHULV]HUR 7RHQDEOH,5PRGHRSHUDWLRQ\RXVHW8/&21>@WR 2WKHUZLVHWKH8$57RSHUDWHVLQQRUPDOPRGH,Q,5 UHFHLYHPRGHWKHUHFHLYHUPXVWGHWHFWWKH SXOVHGSHULRGWRUHFRJQL]HD]HURYDOXHLQWKHUHFHLYHU EXIIHUUHJLVWHU85;%8)DVWKH,5UHFHLYHGDWD :KHQELW>@LVQRUPDO8$57PRGHLVVHOHFWHG:KHQLW LVLQIUDUHG7[5[PRGHLVVHOHFWHG >@ 1XPEHURI6WRSELWV >@ 3DULW\PRGH30' >@ 6HULDO&ORFN6HOHFWLRQ >@ ,QIUDUHGPRGH .6&5,6&0,&52&21752//(5 8$57 , ; 5 3 0 ' 6 7 % : / >@:RUGOHQJWKSHUIUDPH:/ ELWV ELWV ELWV ELWV >@1XPEHURI6WRSELWVDWWKHHQGRIIUDPH67% 2QHVWRSELWSHUIUDPH 7ZRVWRSELWVSHUIUDPH [[ >@3DULW\PRGH30' 1RSDULW\ 2GGSDULW\ (YHQSDULW\ 3DULW\IRUFHGFKHFNHGDV 3DULW\IRUFHGFKHFNHGDV >@6HULDO&ORFN6HOHFWLRQ6& ,QWHUQDO0&/. ([WHUQDO8&/. >@,QIUDUHGPRGHVHOHFWLRQ,5 1RUPDOPRGHRSHUDWLRQ ,QIUDUHG7[5[PRGH )LJXUH8$57/LQH&RQWURO5HJLVWHUV 8$57 .6&5,6&0,&52&21752//(5 8$57&21752/5(*,67(56 7DEOH8&21DQG8&215HJLVWHUV 5HJLVWHU 8&21 8&21 2IIVHW$GGUHVV [' [( 5: 5: 5: 'HVFULSWLRQ 8$57FRQWUROUHJLVWHU 8$57FRQWUROUHJLVWHU 5HVHW9DOXH [ [ 7DEOH8$57&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 5HFHLYHPRGH5[0 'HVFULSWLRQ 7KLVWZRELWYDOXHGHWHUPLQHVZKLFKIXQFWLRQLVFXUUHQWO\ DEOHWRUHDGGDWDIURPWKH8$57UHFHLYHEXIIHUUHJLVWHU 5%5 GLVDEOH5[PRGH LQWHUUXSWUHTXHVW *'0$FKDQQHOUHTXHVWDQG *'0$FKDQQHO UHTXHVW 7KLVELWOHWVWKH8$57JHQHUDWHDQLQWHUUXSWLIDQH[FHSWLRQ DEUHDNIUDPHHUURUSDULW\HUURURURYHUUXQHUURURFFXUV GXULQJDUHFHLYHRSHUDWLRQ ,IWKLVELWLVVHWWRWKH8$57JHQHUDWHVDUHFHLYHVWDWXV LQWHUUXSW,IWKLVELWLVWKHUHFHLYHVWDWXVLQWHUUXSWLVQRW JHQHUDWHG 7KLVWZRELWYDOXHGHWHUPLQHVZKLFKIXQFWLRQLVFXUUHQWO\ DEOHWRZULWH7[GDWDWRWKH8$57WUDQVPLWEXIIHUUHJLVWHU 87;%8) GLVDEOH7[PRGH LQWHUUXSWUHTXHVW *'0$FKDQQHOUHTXHVWDQG *'0$FKDQQHO UHTXHVW 6HWWLQJ8&21>@FDXVHVWKH.6&WRDVVHUWLWVGDWD VHWUHDG\'65VLJQDORXWSXWQ8$'65&OHDULQJWKLVELWWR FDXVHVWKH'65RXWSXWWREHGHDVVHUWHG 6HWWLQJ8&21>@WRFDXVHVWKH8$57WRVHQGD EUHDN,ILWLVDEUHDNLVQRWVHQW $EUHDNLVGHILQHGDVDFRQWLQXRXV/RZOHYHOVLJQDORQWKH WUDQVPLWGDWDRXWSXWZLWKDGXUDWLRQRIPRUHWKDQRQHIUDPH WUDQVPLVVLRQWLPH %\VHWWLQJWKLVELWZKHQWKHWUDQVPLWWHULVHPSW\WUDQVPLWWHU HPSW\ELW867$7>@ \RXFDQXVHWKHWUDQVPLWWHUWR WLPHWKHIUDPH:KHQ867$7>@LVZULWHWKHWUDQVPLW EXIIHUUHJLVWHU87;%8)ZLWKWKHGDWDWREHWUDQVPLWWHG 7KHQSROOWKH867$7>@YDOXH:KHQ867$7>@UHWXUQVWR FOHDUUHVHWWKHVHQGEUHDNELW8&21>@ >@ 5[VWDWXVLQWHUUXSWHQDEOH >@ 7UDQVPLWPRGH7[0 >@ 'DWDVHWUHDG\'65 >@ 6HQGEUHDN .6&5,6&0,&52&21752//(5 8$57 7DEOH8$57&RQWURO5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH /RRSEDFNPRGH 'HVFULSWLRQ 6HWWLQJWKLVELWFDXVHVWKH8$57WRHQWHU/RRSEDFNPRGH ,Q/RRSEDFNPRGHWKHWUDQVPLWGDWDRXWSXWLVVHQW+LJK OHYHODQGWKHWUDQVPLWEXIIHUUHJLVWHU87;%8)LVLQWHUQDOO\ FRQQHFWHGWRWKHUHFHLYHEXIIHUUHJLVWHU85;%8) 127(7KLVPRGHLVSURYLGHGIRUWHVWSXUSRVHVRQO\)RU QRUPDORSHUDWLRQWKLVELWVKRXOGDOZD\VEH / 6 3 3 % 0 % . ' 7 [ 0 5 [ 6 , 5 [ 0 >@6,2UHFHLYHPRGHVHOHFWLRQ5[0 'LVDEOH ,QWHUUXSWUHTXHVW *'0$FKDQQHOUHTXHVW *'0$FKDQQHOUHTXHVW >@5HFHLYHVWDWXVLQWHUUXSWHQDEOH5[6, 'RQRWJHQHUDWHUHFHLYHVWDWXVLQWHUUXSW *HQHUDWHUHFHLYHVWDWXVLQWHUUXSW 'LVDEOH ,QWHUUXSWUHTXHVW *'0$FKDQQHOUHTXHVW *'0$FKDQQHOUHTXHVW >@6,2WUDQVPLWPRGHVHOHFWLRQ7[0 >@'DWDVHWUHDG\'65 'HDVVHUW.6&'65RXWSXWQ8$'65 $VVHUW.6&'65RXWSXWQ8$'65 >@6HQGEUHDN6%. 'RQRWVHQGEUHDN 6HQGEUHDN >@/RRSEDFNHQDEOH/3% 1RUPDORSHUDWLQJPRGH (QDEOH/RRSEDFNPRGHIRUWHVWLQJRQO\ )LJXUH8$57&RQWURO5HJLVWHUV 8$57 .6&5,6&0,&52&21752//(5 8$5767$7865(*,67(56 7DEOH867$7DQG867$75HJLVWHUV 5HJLVWHU 867$7 867$7 2IIVHW$GGUHVV [' [( 5: 5 5 'HVFULSWLRQ 8$57VWDWXVUHJLVWHU 8$57VWDWXVUHJLVWHU 5HVHW9DOXH [& [& 7DEOH8$576WDWXV5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 2YHUUXQHUURU 'HVFULSWLRQ 867$7>@LVDXWRPDWLFDOO\VHWWRZKHQHYHUDQRYHUUXQ HUURURFFXUVGXULQJDVHULDOGDWDUHFHLYHRSHUDWLRQ7KH RYHUUXQHUURULQGLFDWHVWKDWWKHQHZUHFHLYHGGDWDKDV RYHUZULWWHQROGUHFHLYHGGDWDEHIRUHWKHROGGDWDFRXOGEH UHDG ,IWKHUHFHLYHVWDWXVLQWHUUXSWHQDEOHELW8&21>@LVD UHFHLYHVWDWXVLQWHUUXSWLVJHQHUDWHGLIDQRYHUUXQHUURU RFFXUV 7KLVELWLVDXWRPDWLFDOO\FOHDUHGWRZKHQHYHUWKH8$57 VWDWXVUHJLVWHU867$7LVUHDG 867$7>@LVDXWRPDWLFDOO\VHWWRZKHQHYHUDSDULW\HUURU RFFXUVGXULQJDVHULDOGDWDUHFHLYHRSHUDWLRQ,IWKHUHFHLYH VWDWXVLQWHUUXSWHQDEOHELW8&21>@LVDUHFHLYHVWDWXV LQWHUUXSWLVJHQHUDWHGLIDSDULW\HUURURFFXUV 7KLVELWLVDXWRPDWLFDOO\FOHDUHGWRZKHQHYHUWKH8$57 VWDWXVUHJLVWHU867$7LVUHDG 867$7>@LVDXWRPDWLFDOO\VHWWRZKHQHYHUDIUDPHHUURU RFFXUVGXULQJDVHULDOGDWDUHFHLYHRSHUDWLRQ$IUDPHHUURU RFFXUVZKHQD]HURLVGHWHFWHGLQVWHDGRIWKH6WRSELWV ,IWKHUHFHLYHVWDWXVLQWHUUXSWHQDEOHELW8&21>@LVD UHFHLYHVWDWXVLQWHUUXSWLVJHQHUDWHGLIDIUDPHHUURURFFXUV 7KHIUDPHHUURUELWLVDXWRPDWLFDOO\FOHDUHGWRZKHQHYHU WKH8$57VWDWXVUHJLVWHU867$7LVUHDG 867$7>@LVDXWRPDWLFDOO\VHWWRWRLQGLFDWHWKDWDEUHDN VLJQDOKDVEHHQUHFHLYHG ,IWKHUHFHLYHVWDWXVLQWHUUXSWHQDEOHELW8&21>@LVD UHFHLYHVWDWXVLQWHUUXSWLVJHQHUDWHGLIDEUHDNRFFXUV 7KHEUHDNLQWHUUXSWELWLVDXWRPDWLFDOO\FOHDUHGWRZKHQ \RXUHDGWKH8$57VWDWXVUHJLVWHU 7KH867$7>@ELWLQGLFDWHVWKHFXUUHQWVLJQDOOHYHODWWKH GDWDWHUPLQDOUHDG\'75SLQVQ8$'75:KHQWKLVELWLV WKHOHYHODWWKH'75SLQQ8$'75LV/RZ:KHQLWLV WKH'75SLQLV+LJKOHYHO >@ 3DULW\HUURU >@ )UDPHHUURU >@ %UHDNLQWHUUXSW >@ 'DWDWHUPLQDOUHDG\'75 .6&5,6&0,&52&21752//(5 8$57 7DEOH8$576WDWXV5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 5HFHLYHGDWDUHDG\ 'HVFULSWLRQ 867$7>@LVDXWRPDWLFDOO\VHWWRZKHQHYHUWKHUHFHLYH GDWDEXIIHUUHJLVWHU85;%8)FRQWDLQVYDOLGGDWDUHFHLYHG RYHUWKHVHULDOSRUW7KHUHFHLYHGDWDFDQWKHQEHUHDGIURP WKH85;%8):KHQWKLVELWLVWKH85;%8)GRHVQRW FRQWDLQYDOLGGDWD 'HSHQGLQJRQWKHFXUUHQWVHWWLQJRIWKH8$57UHFHLYH PRGHELWV8&21>@DQLQWHUUXSWRUD'0$UHTXHVWLV JHQHUDWHGZKHQ867$7>@LV 867$7>@LVDXWRPDWLFDOO\VHWWRZKHQWKHWUDQVPLW EXIIHUUHJLVWHU87;%8)GRHVQRWFRQWDLQYDOLGGDWD,Q WKLVFDVHWKH87;%8)FDQEHZULWWHQZLWKWKHGDWDWREH WUDQVPLWWHG :KHQWKLVELWLVWKH87;%8)FRQWDLQVYDOLG7[GDWDWKDW KDVQRW\HWEHHQFRSLHGWRWKHWUDQVPLWVKLIWUHJLVWHU,QWKLV FDVHWKH87;%8)FDQQRWEHZULWWHQZLWKQHZ7[GDWD 'HSHQGLQJRQWKHFXUUHQWVHWWLQJRIWKH6,2WUDQVPLWPRGH ELWV8&21>@DQLQWHUUXSWRUD'0$UHTXHVWZLOOEH JHQHUDWHGZKHQHYHU867$7>@LV 867$7>@LVDXWRPDWLFDOO\VHWWRZKHQWKHWUDQVPLW EXIIHUUHJLVWHUKDVQRYDOLGGDWDWRWUDQVPLWDQGZKHQWKH 7[VKLIWUHJLVWHULVHPSW\:KHQWKHWUDQVPLWWHUHPSW\ELWLV LWLQGLFDWHVWRVRIWZDUHWKDWLWFDQQRZGLVDEOHWKH WUDQVPLWWHUIXQFWLRQEORFN >@ 7[%XIIHUUHJLVWHUHPSW\ >@ 7UDQVPLWFRPSOHWH7& 8$57 .6&5,6&0,&52&21752//(5 7 5 ' % ) 3 2 7 % ' 7 . ( ( 9 & ( 5 5 ' >@2YHUUXQHUURU29 1RRYHUUXQHUURUGXULQJUHFHLYH 2YHUUXQHUURUJHQHUDWHUHFHLYHVWDWXVLQWHUUXSWLI8&21>@LV >@3DULW\HUURU3( 1RSDULW\HUURUGXULQJUHFHLYH 3DULW\HUURUJHQHUDWHUHFHLYHVWDWXVLQWHUUXSWLI8&21>@LV >@)UDPHHUURU)( 1RIUDPHHUURUGXULQJUHFHLYH )UDPHHUURUJHQHUDWHUHFHLYHVWDWXVLQWHUUXSWLI8&21>@LV >@%UHDNGHWHFW%.' 1REUHDNUHFHLYHG %UHDNUHFHLYHGJHQHUDWHUHFHLYHVWDWXVLQWHUUXSWLI8&21>@LV >@'DWDWHUPLQDOUHDG\'75 '75SLQQ8$'75LV+LJK '75SLQQ8$'75LV/RZ >@5HFHLYHGDWDUHDG\5'5 1RYDOLGGDWDLQWKHUHFHLYHEXIIHUUHJLVWHU 9DOLGGDWDSUHVHQWLQWKHUHFHLYHEXIIHUUHJLVWHU LVVXHLQWHUUXSWRU'0$UHTXHVWLI8&21>@LVVHW >@7UDQVPLWEXIIHUUHJLVWHUHPSW\7%( 9DOLGGDWDLQWUDQVPLWKROGLQJUHJLVWHU 1RGDWDLQWUDQVPLWKROGLQJUHJLVWHU DVWKHVHWWLQJRI8&21>@LQWHUUXSWRU*'0$UHTXHVWLVJHQHUDWHG >@7UDQVPLWFRPSOHWH7& 7UDQVPLWLQSURJUHVV 7UDQVPLWFRPSOHWHQRGDWDIRU7[ )LJXUH8$576WDWXV5HJLVWHUV .6&5,6&0,&52&21752//(5 8$57 8$5775$160,7%8))(55(*,67(56 7KH8$57WUDQVPLWEXIIHUUHJLVWHUV87;%8)DQG87;%8)FRQWDLQDQELWGDWDYDOXHWREHWUDQVPLWWHGRYHU WKH8$57FKDQQHO 7DEOH8;7%8)DQG8;7%8)5HJLVWHUV 5HJLVWHU 87;%8) 87;%8) 2IIVHW$GGUHVV ['& [(& 5: : : 'HVFULSWLRQ 8$57WUDQVPLWEXIIHUUHJLVWHU 8$57WUDQVPLWEXIIHUUHJLVWHU 5HVHW9DOXH [;; [;; 7DEOH8$577UDQVPLW5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 7UDQVPLWGDWD 'HVFULSWLRQ 7KLVILHOGFRQWDLQVWKHGDWDWREHWUDQVPLWWHGRYHUWKHVLQJOH FKDQQHO8$57 :KHQWKLVUHJLVWHULVZULWWHQWKHWUDQVPLWEXIIHUUHJLVWHU HPSW\ELWLQWKHVWDWXVUHJLVWHU867$7>@VKRXOGEH 7KLVLVWRSUHYHQWRYHUZULWLQJRIWUDQVPLWGDWDWKDWPD\ DOUHDG\EHSUHVHQWLQWKH87;%8) :KHQHYHUWKH87;%8)LVZULWWHQZLWKDQHZYDOXHWKH WUDQVPLWUHJLVWHUHPSW\ELW867$7>@LVDXWRPDWLFDOO\ FOHDUHGWR 7UDQVPLW'DWD >@7UDQVPLWGDWDIRU8$57 )LJXUH8$577UDQVPLW%XIIHU5HJLVWHUV 8$57 .6&5,6&0,&52&21752//(5 8$575(&(,9(%8))(55(*,67(56 7KH8$57UHFHLYHEXIIHUUHJLVWHUV85;%8)DQG85;%8)FRQWDLQDQELWGDWDYDOXHIRUUHFHLYHGVHULDOGDWD 7DEOH8;5%8)DQG8;5%8)5HJLVWHUV 5HJLVWHU 85;%8) 85;%8) 2IIVHW$GGUHVV [' [( 5: 5 5 'HVFULSWLRQ 8$57UHFHLYHEXIIHUUHJLVWHU 8$57UHFHLYHEXIIHUUHJLVWHU 5HVHW9DOXH [;; [;; 7DEOH8$577UDQVPLW5HJLVWHU'HVFULSWLRQ %LW1XPEHU >@ %LW1DPH 5HFHLYHGDWD 'HVFULSWLRQ 7KLVILHOGFRQWDLQVWKHGDWDUHFHLYHGRYHUWKHVLQJOH FKDQQHO8$57 :KHQWKH8$57ILQLVKHVUHFHLYLQJDGDWDIUDPHWKH UHFHLYHGDWDUHDG\ELWLQWKH8$57VWDWXVUHJLVWHU 867$7>@VKRXOGEH7KLVSUHYHQWVUHDGLQJLQYDOLG UHFHLYHGDWDWKDWPD\DOUHDG\EHSUHVHQWLQWKH85;%8) :KHQHYHUWKH85;%8)LVUHDGWKHUHFHLYHGDWDUHDG\ ELW867$7>@LVDXWRPDWLFDOO\FOHDUHGWR 5HFHLYH 'DWD >@5HFHLYHGDWDIRU8$57 )LJXUH8$575HFHLYH%XIIHU5HJLVWHUV .6&5,6&0,&52&21752//(5 8$57 8$57%$8'5$7(',9,6255(*,67(56 7KHYDOXHVVWRUHGLQWKHEDXGUDWHGLYLVRUUHJLVWHUV8%5',9DQG8%5',9OHW\RXGHWHUPLQHWKHVHULDO7[5[ FORFNUDWHEDXGUDWHDVIROORZV %5*287 0&/.RU8&/.&17A&17 7DEOH8%5',9DQG8%5',95HJLVWHUV 5HJLVWHU 8%5',9 8%5',9 2IIVHW$GGUHVV [G [H 5: 5: 5: 'HVFULSWLRQ 8$57EDXGUDWHGLYLVRUUHJLVWHU 8$57EDXGUDWHGLYLVRUUHJLVWHU 5HVHW9DOXH [ [ &17 &17 >@%DXGUDWHGLYLVRUYDOXH&17 [[[ GLYLGHE\ [[[ GLYLGHE\ >@7LPHFRQVWDQWYDOXHIRU&17 )LJXUH8$57%DXG5DWH'LYLVRU5HJLVWHUV 8$57 .6&5,6&0,&52&21752//(5 8$57%$8'5$7((;$03/(6 8$57%5*LQSXWFORFN0&/.LVWKHV\VWHPFORFNIUHTXHQF\GLYLGHGE\ ,IWKHV\VWHPFORFNIUHTXHQF\LV0+]DQG0&/.LVVHOHFWHGWKHPD[LPXP%5*287RXWSXWFORFNUDWHLV 0&/. 0+] 8&/.LVWKHH[WHUQDOFORFNLQSXWSLQIRU8$578$578$57%5*LQSXWFORFN0&/.8&/.FDQEHVHOHFWHGE\ 8&&21>@UHJLVWHU &17 0&/. 8&/. ELW&RXQWHU &17 'LYLGHE\RU 'LYLGHE\ %5*287 6DPSOH&ORFN 6& 127( &17 8%5',9Q>@&17 8%5',9Q>@6& 8/&21>@ )LJXUH8$57%DXG5DWH*HQHUDWRU%5* 7DEOH7\SLFDO%DXG5DWHV([DPSOHVRI8$57 %DXG5DWHV %5*287 0&/. 0+] &17 &17 )UHT 8&/. 0+] 'HY &17 &17 )UHT 'HY .6&5,6&0,&52&21752//(5 8$57 75$160,77(5! 87;'Q 7+5( :5B7+5 ,17B7;' 6WDUW 'DWD%LWV 3DULW\ 6WRS 6WDUW 5(&(,9(5! 85;'Q ,17B5;' 85;%8) 3UHYLRXV5HFHLYH'DWD 9DOLG5HFHLYH'DWD 6WDUW 'DWD%LWV 3DULW\ 6WRS 6WDUW 'DWD%LWV )LJXUH,QWHUUXSW%DVHG6HULDO,27LPLQJ'LDJUDP7[DQG5[2QO\ 8$57 .6&5,6&0,&52&21752//(5 75$160,77(5! 7[( 7[' 7+5( :5B7+5 Q;'5(4 Q;'$&. 6HOHFW'0$0RGH 6WDUW 'DWD%LWV 3DULW\ 6WRS )LJXUH'0$%DVHG6HULDO,27LPLQJ'LDJUDP7[2QO\ 5(&(,9(5! 5[( 85;'Q 85;%8)Q Q;'5(4 Q;'$&. 6HOHFW'0$0RGH 6WDUW 'DWD%LWV 3UHYLRXV5HFHLYH'DWD 3DULW\ 6WRS 6WDUW 'DWD%LWV 9DOLG5HFHLYH'DWD )LJXUH'0$%DVHG6HULDO,27LPLQJ'LDJUDP5[2QO\ .6&5,6&0,&52&21752//(5 8$57 6,2)UDPH 6WDUW %LW 6WRS %LW 'DWD%LWV )LJXUH6HULDO,2)UDPH7LPLQJ'LDJUDP1RUPDO8$57 ,57UDQVPLW)UDPH 6WDUW %LW 'DWD%LWV 6WRS %LW 7 %LWIUDPH 7 7 7 )LJXUH,QIUD5HG7UDQVPLW0RGH)UDPH7LPLQJ'LDJUDP 8$57 .6&5,6&0,&52&21752//(5 ,55HFHLYH)UDPH 6WDUW %LW 'DWD%LWV 6WRS %LW 7 %LWIUDPH 7 7 )LJXUH,QIUD5HG5HFHLYH0RGH)UDPH7LPLQJ'LDJUDP .6&5,6&0,&52&21752//(5 %,77,0(56 29(59,(: %,77,0(56 7KH.6&KDVWZRELWWLPHUV7KHVHWLPHUVFDQRSHUDWHLQLQWHUYDOPRGHRULQWRJJOHPRGH7KHRXWSXW VLJQDOVDUH7287DQG7287UHVSHFWLYHO\ <RXHQDEOHRUGLVDEOHWKHWLPHUVE\VHWWLQJFRQWUROELWVLQWKHWLPHUFRQWUROUHJLVWHU7&21$QLQWHUUXSWUHTXHVWLV JHQHUDWHGZKHQHYHUDWLPHUFRXQWRXWGRZQFRXQWRFFXUV ,17(59$/02'(23(5$7,21 ,QLQWHUYDOPRGHDWLPHUJHQHUDWHVDRQHVKRWSXOVHRIDSUHVHWWLPHUFORFNGXUDWLRQZKHQHYHUDWLPHRXWRFFXUV 7KLVSXOVHJHQHUDWHVDWLPHRXWLQWHUUXSWWKDWLVGLUHFWO\RXWSXWDWWKHWLPHUVFRQILJXUHGRXWSXWSLQ7287Q,QWKLV FDVHWKHWLPHUIUHTXHQF\PRQLWRUHGDWWKH7287QSLQLVFDOFXODWHGDV I7287 I0&/.7LPHUGDWDYDOXH 72**/(02'(23(5$7,21 ,QWRJJOHPRGHWKHWLPHUSXOVHFRQWLQXHVWRWRJJOHZKHQHYHUDWLPHRXWRFFXUV$QLQWHUUXSWUHTXHVWLVJHQHUDWHG ZKHQHYHUWKHOHYHORIWKHWLPHURXWSXWVLJQDOLVLQYHUWHGWKDWLVZKHQWKHOHYHOWRJJOHV7KHWRJJOHSXOVHLVRXWSXW GLUHFWO\DWWKHFRQILJXUHGRXWSXWSLQ 8VLQJWRJJOHPRGH\RXFDQDFKLHYHDIOH[LEOHWLPHUFORFNUDQJHZLWKGXW\,QWRJJOHPRGHWKHWLPHUIUHTXHQF\ PRQLWRUHGDWWKH7287QSLQLVFDOFXODWHGDVIROORZV I7287 I0&/.7LPHUGDWDYDOXH I 7287 ,17(59$/02'( 7LPHRXW 72**/(02'( ,1,7,$/7287Q,6 7LPHRXW I 7287 7LPHRXW )LJXUH7LPHU2XWSXW6LJDQO7LPLQJ %,77,0(56 .6&5,6&0,&52&21752//(5 7,0(523(5$7,21*8,'(/,1(6 7KHEORFNGLDJUDPLQ)LJXUHVKRZVKRZWKHELWWLPHUVDUHFRQILJXUHGLQWKH.6&7KHIROORZLQJ JXLGHOLQHVDSSO\WRWLPHUIXQFWLRQV :KHQDWLPHULVHQDEOHGLWORDGVDGDWDYDOXHWRLWVFRXQWUHJLVWHUDQGEHJLQVGHFUHPHQWLQJWKHFRXQWUHJLVWHU YDOXH :KHQWKHWLPHULQWHUYDOH[SLUHVWKHDVVRFLDWHGLQWHUUXSWLVJHQHUDWHG7KHEDVHYDOXHLVWKHQUHORDGHGDQGWKH WLPHUFRQWLQXHVGHFUHPHQWLQJLWVFRXQWUHJLVWHUYDOXH ,IDWLPHULVGLVDEOHG\RXFDQZULWHDQHZEDVHYDOXHLQWRLWVUHJLVWHUV ,IWKHWLPHULVKDOWHGZKLOHLWLVUXQQLQJWKHEDVHYDOXHLVQRWDXWRPDWLFDOO\UHORDGHG %,77,0(5'$7$ 5(*,67(57'$7$Q $872 5(/2$' ,1731'DQG ,1706. 31' ,17(55837 5(48(67 I 0&/. 702'7(Q %,77,0(5&2817 5(*,67(57&17Q >'2:1&2817(5@ 702'70'Q 702'7&/5Q 38/6( *(1(5$725 32573257 '$7$287 ,23&2172(1Q 7287Q )LJXUH%LW7LPHU%ORFN'LDJUDP .6&5,6&0,&52&21752//(5 %,77,0(56 7,0(502'(5(*,67(5 7KHWLPHUPRGHUHJLVWHU702'LVXVHGWRFRQWUROWKHRSHUDWLRQRIWKHWZRELWWLPHUV702'UHJLVWHUVHWWLQJV DUHGHVFULEHGLQ)LJXUH 7DEOH702'5HJLVWHU 5HJLVWHU 702' 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ 7LPHUPRGHUHJLVWHU 5HVHW9DOXH K 7 & / 5 >@7LPHUHQDEOH7( 'LVDEOHWLPHU (QDEOHWLPHU ,QWHUYDOPRGH 7RJJOHPRGH 7 7 7 & 0 ( / ' 5 7 7 0 ( ' >@7LPHUPRGHVHOHFWLRQ70' >@7LPHULQLWLDO7287YDOXH7&/5 ,QLWLDO7287LVLQWRJJOHPRGH ,QLWLDO7287LVLQWRJJOHPRGH >@7LPHUHQDEOH7( 'LVDEOHWLPHU (QDEOHWLPHU ,QWHUYDOPRGH 7RJJOHPRGH >@7LPHUPRGHVHOHWLRQ70' >@7LPHULQLWLDO7287YDOXH7&/5 ,QLWLDO7287LVLQWRJJOHPRGH ,QLWLDO7287LVLQWRJJOHPRGH )LJXUH7LPHU0RGH5HJLVWHU702' %,77,0(56 .6&5,6&0,&52&21752//(5 7,0(5'$7$5(*,67(56 7KHWLPHUGDWDUHJLVWHUV7'$7$DQG7'$7$FRQWDLQDYDOXHWKDWVSHFLILHVWKHWLPHRXWGXUDWLRQIRUHDFKWLPHU 7KHIRUPXODIRUFDOFXODWLQJWKHWLPHRXWGXUDWLRQLV7LPHUGDWDF\FOHV 7DEOH7'$7$DQG7'$7$5HJLVWHUV 5HJLVWHU 7'$7$ 7'$7$ 2IIVHW$GGUHVV [ [ 5: 5: 5: 'HVFULSWLRQ 7LPHUGDWDUHJLVWHU 7LPHUGDWDUHJLVWHU 5HVHW9DOXH [ [ 7LPHU'DWD >@7LPHUGDWDYDOXH )LJXUH7LPHU'DWD5HJLVWHUV7'$7$7'$7$ .6&5,6&0,&52&21752//(5 %,77,0(56 7,0(5&28175(*,67(56 7KHWLPHUFRXQWUHJLVWHUV7&17DQG7&17FRQWDLQWKHFXUUHQWWLPHUDQGFRXQWYDOXHUHVSHFWLYHO\GXULQJ QRUPDORSHUDWLRQ 7DEOH7&17DQG7&175HJLVWHUV 5HJLVWHU 7&17 7&17 2IIVHW$GGUHVV [& [ 5: 5: 5: 'HVFULSWLRQ 7LPHUFRXQWUHJLVWHU 7LPHUFRXQWUHJLVWHU 5HVHW9DOXH [IIIIIIII [IIIIIIII 7LPHU&RXQW >@7LPHUFRXQWYDOXH )LJXUH7LPHU&RXQW5HJLVWHUV7&177&17 %,77,0(56 .6&5,6&0,&52&21752//(5 127(6 .6&5,6&0,&52&21752//(5 ,232576 ,232576 7KH.6&KDVSURJUDPPDEOH,2SRUWV<RXFDQFRQILJXUHHDFK,2SRUWWRLQSXWPRGHRXWSXWPRGHRU VSHFLDOIXQFWLRQPRGH7RGRWKLV\RXZULWHWKHDSSURSULDWHVHWWLQJVWRWKH,2302'DQG,23&21UHJLVWHUV8VHU FDQVHWILOWHULQJIRUWKHLQSXWSRUWVXVLQJ,23&21UHJLVWHU 7KHPRGHVRIWKHSRUWVIURPSRUWWRSRUWDUHGHWHUPLQHGRQO\E\WKH,2302'UHJLVWHU%XWSRUW>@FDQEH XVHGDV[,175(4>@SRUW>@DVQ;'5(4>@SRUW>@DVQ;'$&.>@SRUW>@DV7287RUSRUW>@ DV7287GHSHQGLQJRQWKHVHWWLQJVLQ,23&21UHJLVWHU ,2302' ,23&21 $/7(51$7()81&7,216 6 < 6 7 ( 0 % 8 6 287387 /$7&+ 9'' 32573257 3257[,175(4 ,23'$7$ :5,7( 3257[,175(4 3257Q;'5(4 3257Q;'5(4 3257Q;'$&. 3257Q;'$&. 32577287 32577287 ),/7(5 212)) ,23'$7$ 5($' ,1387 /$7&+ ,17(5583725'0$ 5(48(67 $&7,9( 212)) ('*( '(7(&7,21 ,23&21 ,23&21 )LJXUH,23RUW)XQFWLRQ'LDJUDP ,232576 .6&5,6&0,&52&21752//(5 ,2325763(&,$/5(*,67(56 7KUHHUHJLVWHUVFRQWUROWKH,2SRUWFRQILJXUDWLRQ,2302',23&21DQG,23'$7$7KHVHUHJLVWHUVDUH GHVFULEHGLQGHWDLOEHORZ ,2325702'(5(*,67(5,2302' 7KH,2SRUWPRGHUHJLVWHU,2302'LVXVHGWRFRQILJXUHWKHSRUWSLQV33 127( ,IWKHSRUWLVXVHGIRUDVSHFLDOIXFWLRQVXFKDVDQH[WHUQDOLQWHUUXSWUHTXHVWDQH[WHUQDO'0$ UHTXHVWRUDFNQRZOHGJHVLJQDODQGWLPHURXWSXWVLWVPRGHLVGHWHUPLQHGE\WKH,23&21UHJLVWHU QRWE\,2302' 7DEOH,2302'5HJLVWHU 5HJLVWHU ,2302' 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ ,2SRUWPRGHUHJLVWHU 5HVHW9DOXH [ ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; >@,2SRUWPRGHELWIRUSRUW ,QSXW 2XWSXW ,QSXW 2XWSXW ,QSXW 2XWSXW >@,2SRUWPRGHELWIRUSRUW >@,2SRUWPRGHELWIRUSRUW >@,2SRUWPRGHELWIRUSRUW ,QSXW 2XWSXW )LJXUH,23RUW0RGH5HJLVWHU,2302' .6&5,6&0,&52&21752//(5 ,232576 ,23257&21752/5(*,67(5,23&21 7KH,2SRUWFRQWUROUHJLVWHU,23&21LVXVHGWRFRQILJXUHWKHSRUWSLQV33 127( ,IWKHSRUWLVXVHGIRUDVSHFLDOIXFWLRQVXFKDVDQH[WHUQDOLQWHUUXSWUHTXHVWDQH[WHUQDO'0$ UHTXHVWRUDFNQRZOHGJHVLJQDODQGWLPHURXWSXWVLWVPRGHLVGHWHUPLQHGE\WKH,23&21UHJLVWHU QRWE\,2302' )RUWKHVSHFLDOLQSXWSRUWV.6&SURYLGHVWDSILOWHULQJ,IWKHLQSXWVLJQDOOHYHOVDUHVDPHIRUWKHWKUHH V\VWHPFORFNSHULRGVWKDWOHYHOLVWDNHQDVLQSXWIRUGHGLFDWHGVLJQDOVVXFKDVH[WHUQDOLQWHUUXSWUHTXHVWVDQG H[WHUQDO'0$UHTXHVWV 7DEOH,23&215HJLVWHU 5HJLVWHU ,23&21 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ ,2SRUWFRQWUROUHJLVWHU 5HVHW9DOXH [ ,232576 .6&5,6&0,&52&21752//(5 7 2 ( 1 7 2 ( 1 ' $ . ' $ . ' 5 4 ' 5 4 [ , 5 4 [ , 5 4 [ , 5 4 [ , 5 4 >@&RQWUROH[WHUQDOLQWHUUXSWUHTXHVWLQSXWIRUSRUW[,54 >@3RUWIRU[,175(4 'LVDEOH >@ $FWLYH/RZ >@ )LOWHULQJRII >@ /HYHOGHWHFWLRQ )DOOLQJHGJHGHWHFWLRQ (QDEOH $FWLYH+LJK )LOWHULQJRQ 5LVLQJHGJHGHWHFWLRQ %RWKHGJHGHWHFWLRQ >@&RQWUROH[WHUQDOLQWHUUXSWUHTXHVWLQSXWIRUSRUW[,54 6HHFRQWUROH[WHUQDOLQWHUUXSWUHTXHVW 6HHFRQWUROH[WHUQDOLQWHUUXSWUHTXHVW 6HHFRQWUROH[WHUQDOLQWHUUXSWUHTXHVW >@3RUWIRUQ;'5(4 'LVDEOH >@ )LOWHULQJRII >@ $FWLYH/RZ >@3RUWIRUQ;'5(4 'LVDEOH >@ )LOWHULQJRII >@ $FWLYH/RZ >@3RUWIRUQ;'$&. 'LVDEOH >@ $FWLYH/RZ >@3RUWIRUQ;'$&. 'LVDEOH >@ $FWLYH/RZ 'LVDEOH 'LVDEOH >@&RQWUROH[WHUQDOLQWHUUXSWUHTXHVWLQSXWIRUSRUW[,54 >@&RQWUROH[WHUQDOLQWHUUXSWUHTXHVWLQSXWIRUSRUW[,54 >@&RQWUROH[WHUQDO'0$UHTXHVWLQSXWIRUSRUW'54 (QDEOH )LOWHULQJRQ $FWLYH+LJK >@&RQWUROH[WHUQDO'0$UHTXHVWLQSXWIRUSRUW'54 (QDEOH )LOWHULQJRQ $FWLYH+LJK >@&RQWUROH[WHUQDO'0$DFNQRZOHGJHRXWSXWIRUSRUW'$. (QDEOH $FWLYH+LJK >@&RQWUROH[WHUQDO'0$DFNQRZOHGJHRXWSXWIRUSRUW'$. (QDEOH $FWLYH+LJK (QDEOH (QDEOH >@&RQWUROWLPHRXWIRUSRUW72(1 >@&RQWUROWLPHRXWIRUSRUW72(1 )LJXUH,23RUW&RQWURO5HJLVWHU,23&21 .6&5,6&0,&52&21752//(5 ,232576 ,23257'$7$5(*,67(5,23'$7$ 7KH,2SRUWGDWDUHJLVWHU,23'$7$FRQWDLQVRQHELWUHDGYDOXHVIRU,2SRUWVWKDWDUHFRQILJXUHGWRLQSXWPRGH DQGRQHELWZULWHYDOXHVIRUSRUWVWKDWDUHFRQILJXUHGWRRXWSXWPRGH%LWV>@RIWKHELW,2SRUWUHJLVWHUYDOXH FRUUHVSRQGGLUHFWO\WRWKHSRUWSLQV33 7DEOH,23'$7$5HJLVWHU 5HJLVWHU ,23'$7$ 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ ,2SRUWGDWDUHJLVWHU 5HVHW9DOXH 8QGHILQHG 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 >@,2SRUWUHDGZULWHYDOXHVIRUSRUWV33 127(7KHYDOXHVLQWKH,2SRUWGDWDUHJLVWHUUHIOHFWWKHVLJQDOOHYHORQWKH UHVSHFWLYH,2SRUWSLQV:KHQWKHSRUWVDUHFRQILJXUHGWRRXWSXWPRGHWKH ELWUHIOHFWVWKHSRUWVZULWHYDOXH:KHQWKHSRUWLVFRQILJXUHGWRLQSXWPRGH WKHELWUHIOHFWVWKHSRUWVUHDGYDOXH )LJXUH,23RUW'DWD5HJLVWHU,23'$7$ ,232576 .6&5,6&0,&52&21752//(5 0&/. [,175(4Q ,17(51$/,175(4Q ,23&21[,54Q>@ ,23&21[,54Q>@ ,23&21[,54Q>@ ,23&21[,54Q>@ )LJXUH([WHUQDO,QWHUUXSW5HTXHVW7LPLQJ$FWLYH+LJK 0&/. [,175(4Q ,17(51$/,175(4Q ,23&21[,54Q>@ ,23&21[,54Q>@ ,23&21[,54Q>@ ,23&21[,54Q>@ )LJXUH([WHUQDO,QWHUUXSW5HTXHVW7LPLQJ$FWLYH/RZ .6&5,6&0,&52&21752//(5 ,17(55837&21752//(5 ,17(55837&21752//(5 7KH.6&LQWHUUXSWFRQWUROOHUKDVDWRWDORILQWHUUXSWVRXUFHV,QWHUUXSWUHTXHVWVFDQEHJHQHUDWHGE\ LQWHUQDOIXQFWLRQEORFNVDQGDWH[WHUQDOSLQV 7KH$507'0,FRUHUHFRQJQL]HVWZRNLQGVRILQWHUUXSWVDQRUPDOLQWHUUXSWUHTXHVW,54DQGDIDVWLQWHUUXSW UHTXHVW),47KHUHIRUHDOO.6&LQWHUUXSWVFDQEHFDWHJRUL]HGDVHLWKHU,54RU),47KH.6& LQWHUUXSWFRQWUROOHUKDVDQLQWHUUXSWSHQGLQJELWIRUHDFKLQWHUUXSWVRXUFH )RXUVSHFLDOUHJLVWHUVDUHXVHGWRFRQWUROLQWHUUXSWJHQHUDWLRQDQGKDQGOLQJ ,QWHUUXSWSULRULW\UHJLVWHUV7KHLQGH[QXPEHURIHDFKLQWHUUXSWVRXUFHLVZULWWHQWRWKHSUHGHILQHGLQWHUUXSW SULRULW\UHJLVWHUILHOGWRREWDLQWKDWSULRULW\7KHLQWHUUXSWSULRULWLHVDUHSUHGHILQHGIURPWR ,QWHUUXSWPRGHUHJLVWHU'HILQHVWKHLQWHUUXSWPRGH,54RU),4IRUHDFKLQWHUUXSWVRXUFH ,QWHUUXSWSHQGLQJUHJLVWHU,QGLFDWHVWKDWDQLQWHUUXSWUHTXHVWLVSHQGLQJ,IWKHSHQGLQJELWLVVHWWKHLQWHUUXSW SHQGLQJVWDWXVLVPDLQWDLQHGXQWLOWKH&38FOHDUVLWE\ZULWLQJDWRWKHDSSURSULDWHSHQGLQJUHJLVWHU:KHQ WKHSHQGLQJELWLVVHWWKHLQWHUUXSWVHUYLFHURXWLQHVWDUWVZKHQHYHUWKHLQWHUUXSWPDVNUHJLVWHULV7KH VHUYLFHURXWLQHPXVWFOHDUWKHSHQGLQJFRQGLWLRQE\ZULWLQJDWRWKHDSSURSULDWHSHQGLQJELW7KLVDYRLGVWKH SRVVLELOLW\RIFRQWLQXRXVLQWHUUXSWUHTXHVWVIURPWKHVDPHLQWHUUXSWSHQGLQJELW ,QWHUUXSWPDVNUHJLVWHU,QGLFDWHVWKDWWKHFXUUHQWLQWHUUXSWKDVEHHQGLVDEOHGLIWKHFRUUHVSRQGLQJPDVNELWLV ,IDQLQWHUUXSWPDVNELWLVWKHLQWHUUXSWZLOOEHVHUYLFHGQRUPDOO\,IWKHJOREDOPDVNELWELWLVVHWWR QRLQWHUUXSWVDUHVHUYLFHG+RZHYHUWKHVRXUFHVSHQGLQJELWLVVHWLIWKHLQWHUUXSWLVJHQHUDWHG:KHQWKH JOREDOPDVNELWKDVEHHQVHWWRWKHLQWHUUXSWLVVHUYLFHG ,17(55837&21752//(5 .6&5,6&0,&52&21752//(5 ,17(558376285&(6 7KHLQWHUUXSWVRXUFHVLQWKH.6&LQWHUUXSWVWUXFWXUHDUHOLVWHGLQEULHIDVIROORZV 7DEOH.6&,QWHUUXSW6RXUFHV ,QGH[9DOXHV >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ >@ ,&EXVLQWHUUXSW (WKHUQHWFRQWUROOHU0$&5[LQWHUUXSW (WKHUQHWFRQWUROOHU0$&7[LQWHUUXSW (WKHUQHWFRQWUROOHU%'0$5[LQWHUUXSW (WKHUQHWFRQWUROOHU%'0$7[LQWHUUXSW +'/&FKDQQHO%5[LQWHUUXSW +'/&FKDQQHO%7[LQWHUUXSW +'/&FKDQQHO$5[LQWHUUXS +'/&FKDQQHO$7[LQWHUUXSW 7LPHULQWHUUXSW 7LPHULQWHUUXSW *'0$FKDQQHOLQWHUUXSW *'0$FKDQQHOLQWHUUXSW 8$57UHFHLYHHUURULQWHUUXSW 8$57WUDQVPLWLQWHUUXSW 8$57UHFHLYHHUURULQWHUUXSW 8$57WUDQVPLWLQWHUUXSW ([WHUQDOLQWHUUXSW ([WHUQDOLQWHUUXSW ([WHUQDOLQWHUUXSW ([WHUQDOLQWHUUXSW ,QWHUUXSW6RXUFH .6&5,6&0,&52&21752//(5 ,17(55837&21752//(5 ,17(55837&21752//(563(&,$/5(*,67(56 ,17(5583702'(5(*,67(5 %LWVHWWLQJVLQWKHLQWHUUXSWPRGHUHJLVWHU,1702'VSHFLI\LIDQLQWHUUXSWLVWREHVHUYLFHGDVDIDVWLQWHUUXSW),4 RUDQRUPDOLQWHUUXSW,54 7DEOH,1702'5HJLVWHU 5HJLVWHU ,1702' 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ ,QWHUUXSWPRGHUHJLVWHU 5HVHW9DOXH [ ,1702' ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; >@,QWHUUXSWPRGHELWV 127((DFKRIWKHELWVLQWKHLQWHUUXSWPRGHHQDEOHUHJLVWHU ,1702'FRUUHVSRQGVWRDQLQWHUUXSWVRXUFH:KHQWKH VRXUFHLQWHUUXSWPRGHELWLVVHWWRWKHLQWHUUXSWLV SURFHVVHGE\WKH$507'0,FRUHLQ),4IDVWLQWHUUXSW PRGH2WKHUZLVHLWLVSURFHVVHGLQ,54PRGHQRUPDO LQWHUUXSW7KHLQWHUUXSWVRXUFHVDUHPDSSHGDVIROORZV >@, &LQWHUUXSW >@(WKHUQHWFRQWUROOHU0$&5[LQWHUUXSW >@(WKHUQHWFRQWUROOHU0$&7[LQWHUUXSW >@(WKHUQHWFRQWUROOHU%'0$5[L QWHUUXSW >@(WKHUQHWFRQWUROOHU%'0$7[LQWHUUXSW >@+'/&FKDQQHO%5[LQWHUUXSW >@+'/&FKDQQHO%7[LQWHUUXSW >@+'/&FKDQQHO$5[LQWHUUXSW >@+'/&FKDQQHO$7[LQWHUUXSW >@7LPHULQWHUUXSW >@7LPHULQWHUUXSW >@*'0$FKDQQHOLQWHUUXSW >@*'0$FKDQQHOLQWHUUXSW >@8$57UHFHLYHHUURULQWHUUXSW >@8$57WUDQVPLWLQWHUUXSW >@8$57UHFHLYHHUURULQWHUUXSW >@8$57WUDQVPLWLQWHUUXSW >@([WHUQDOLQWHUUXSW >@([WHUQDOLQWHUUXSW >@([WHUQDOLQWHUUXSW >@([WHUQDOLQWHUUXSW )LJXUH,QWHUUXSW0RGH5HJLVWHU,1702' ,17(55837&21752//(5 .6&5,6&0,&52&21752//(5 ,17(558373(1',1*5(*,67(5 7KHLQWHUUXSWSHQGLQJUHJLVWHU,1731'FRQWDLQVLQWHUUXSWSHQGLQJELWVIRUHDFKLQWHUUXSWVRXUFH7KLVUHJLVWHUKDV WREHFOHDUHGDWWKHWRSRIDLQWHUUXSWVHUYLFHURXWLQH 7DEOH,1731'5HJLVWHU 5HJLVWHU ,1731' 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ ,QWHUUXSWSHQGLQJUHJLVWHU 5HVHW9DOXH [ ,1731' ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; >@,QWHUUXSWSHQGLQJELWV 127((DFKRIWKHELWVLQWKHLQWHUUXSWSHQGLQJUHJLVWHU ,1731'FRUUHVSRQGVWRDQLQWHUUXSWVRXUFH:KHQ DQLQWHUUXSWUHTXHVWLVJHQHUDWHGLWVSHQGLQJELWLVVHWWR 7KHVHUYLFHURXWLQHPXVWWKHQFOHDUWKHSHQGLQJ FRQGLWLRQE\ZULWLQJDWRWKHDSSURSULDWHSHQGLQJELWDWVWDUW 7KHLQWHUUXSWVRXUFHVDUHPDSSHGDVIROORZV >@, &LQWHUUXSW >@(WKHUQHWFRQWUROOHU0$&5[LQWHUUXSW >@(WKHUQHWFRQWUROOHU0$&7[LQWHUUXSW >@(WKHUQHWFRQWUROOHU%'0$5[LQWHU UXSW >@(WKHUQHWFRQWUROOHU%'0$7[LQWHUUXSW >@+'/&FKDQQHO%5[LQWHUUXSW >@+'/&FKDQQHO%7[LQWHUUXSW >@+'/&FKDQQHO$5[LQWHUUXSW >@+'/&FKDQQHO$7[LQWHUUXSW >@7LPHULQWHUUXSW >@7LPHULQWHUUXSW >@*'0$FKDQQHOLQWHUUXSW >@*'0$FKDQQHOLQWHUUXSW >@8$57UHFHLYHHUURULQWHUUXSW >@8$57WUDQVPLWLQWHUUXSW >@8$57UHFHLYHHUURULQWHUUXSW >@8$57WUDQVPLWLQWHUUXSW >@([WHUQDOLQWHUUXSW >@([WHUQDOLQWHUUXSW >@([WHUQDOLQWHUUXSW >@([WHUQDOLQWHUUXSW )LJXUH,QWHUUXSW3HQGLQJ5HJLVWHU,1731' .6&5,6&0,&52&21752//(5 ,17(55837&21752//(5 ,17(558370$6.5(*,67(5 7KHLQWHUUXSWPDVNUHJLVWHU,1706.FRQWDLQVLQWHUUXSWPDVNELWVIRUHDFKLQWHUUXSWVRXUFH 7DEOH,1706.5HJLVWHU 5HJLVWHU ,1706. 2IIVHW$GGUHVV [ 5: 5: 'HVFULSWLRQ ,QWHUUXSWPDVNUHJLVWHU 5HVHW9DOXH [))))) ,1706. * ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; >@,QGLYLGXDOLQWHUUXSWPDVNELWV 127((DFKRIWKHELWVLQWKHLQWHUUXSWPDVNUHJLVWHU,1706. H[FHSWIRUWKHJOREDOPDVNELW*FRUUHVSRQGVWRDQLQWHUUXSW VRXUFH:KHQDVRXUFHLQWHUUXSWPDVNELWLVWKHLQWHUUXSWLVQRW VHUYLFHGE\WKH&38ZKHQWKHFRUUHVSRQGLQJLQWHUUXSWUHTXHVWLV JHQHUDWHG,IWKHPDVNELWLVWKHLQWHUUXSWLVVHUYLFHGXSRQ UHTXHVW$QGLIJOREDOPDVNELWELWLVQRLQWHUUXSWVDUH VHUYLFHG+RZHYHUWKHVRXUFHSHQGLQJELWLVVHWZKHQHYHUWKH LQWHUUXSWLVJHQHUDWHG$IWHUWKHJOREDOPDVNELWLVFOHDUHGWKH LQWHUUXSWLVVHUYLFHG7KHLQWHUUXSWVRXUFHVDUHPDSSHGDV IROORZV >@, &LQWHUUXSW >@(WKHUQHWFRQWUROOHU0$&5[LQWHUUXSW >@(WKHUQHWFRQWUROOHU0$&7 [LQWHUUXSW >@(WKHUQHWFRQWUROOHU%'0$5[LQWHUUXSW >@(WKHUQHWFRQWUROOHU%'0$7[LQWHUUXSW >@+'/&FKDQQHO%5[LQWHUUXSW >@+'/&FKDQQHO%7[LQWHUUXSW >@+'/&FKDQQHO$5[LQWHUUXSW >@+'/&FKDQQHO$7[LQWHUUXSW >@7LPHULQWHUUXSW >@7LPHULQWHUUXSW >@*'0$FKDQQHOLQWHUUXSW >@*'0$FKDQQHOLQWHUUXSW >@8$57UHFHLYHHUURULQWHUUXSW >@8$57WUDQVPLWLQWHUUXSW >@8$57UHFHLYHHUURULQWHUUXSW >@8$57WUDQVPLWLQWHUUXSW >@([WHUQDOLQWHUUXSW >@([WHUQDOLQWHUUXSW >@([WHUQDOLQWHUUXSW >@([WHUQDOLQWHUUXSW >@*OREDOLQWHUUXSWPDVNELW (QDEOHLQWHUUXSWUHTXHVWV 'LVDEOHDOOLQWHUUXSWUHTXHVWV )LJXUH,QWHUUXSW0DVN5HJLVWHU,1706. ,17(55837&21752//(5 .6&5,6&0,&52&21752//(5 ,17(5583735,25,7<5(*,67(56 7KHLQWHUUXSWSULRULW\UHJLVWHUV,1735,,1735,FRQWDLQLQIRUPDWLRQDERXWZKLFKLQWHUUXSWVRXUFHLVDVVLJQHGWR WKHSUHGHILQHGLQWHUUXSWSULRULW\ILHOG(DFK,1735,QUHJLVWHUYDOXHGHWHUPLQHVWKHSULRULW\RIWKHFRUUHVSRQGLQJ LQWHUUXSWVRXUFH7KHORZHVWSULRULW\YDOXHLVSULRULW\DQGWKHKLJKHVWSULRULW\YDOXHLVSULRULW\ 7KHLQGH[YDOXHRIHDFKLQWHUUXSWVRXUFHLVZULWWHQWRRQHRIWKHDERYHSRVLWLRQVVHH)LJXUH7KHSRVLWLRQ YDOXHWKHQEHFRPHVWKHZULWWHQLQWHUUXSWVSULRULW\YDOXH7KHLQGH[YDOXHRIHDFKLQWHUUXSWVRXUFHLVOLVWHGLQ7DEOH 7DEOH,QWHUUXSW3ULRULW\5HJLVWHU2YHUYLHZ 5HJLVWHUV ,1735, ,1735, ,1735, ,1735, ,1735, ,1735, 2IIVHW$GGUHVV [& [ [ [ [& [ 5: 5: 5: 5: 5: 5: 5: 'HVFULSWLRQ ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU ,QWHUUXSWSULRULW\UHJLVWHU 5HVHW9DOXH [ [ [%$ [)('& [ [ ,1735, ,1735, ,1735, ,1735, ,1735, ,1735, 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< /2: 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< 35,25,7< +,*+ 35,25,7< 35,25,7< +,*+35,25,7< /2:35,25,7< )LJXUH,QWHUUXSW3ULRULW\5HJLVWHUV,1735,Q .6&5,6&0,&52&21752//(5 ,17(55837&21752//(5 ,17(558372))6(75(*,67(5 7KHLQWHUUXSWRIIVHWUHJLVWHU,172))6(7FRQWDLQVWKHLQWHUUXSWRIIVHWDGGUHVVRIWKHLQWHUUXSWZKLFKKDVWKH KLJKHVWSULRULW\DPRQJWKHSHQGLQJLQWHUUXSWV7KHFRQWHQWRIWKHLQWHUUXSWRIIVHWDGGUHVVLVELWSRVLWLRQYDOXHRIWKH LQWHUUXSWVRXUFH ,IDOOLQWHUUXSWSHQGLQJELWVDUHZKHQ\RXUHDGWKLVUHJLVWHUWKHUHWXUQYDOXHLV[ 7KLVUHJLVWHULVYDOLGRQO\XQGHUWKH,54RU),4PRGHLQWKH$507'0,,QWKHLQWHUUXSWVHUYLFHURXWLQH\RXVKRXOG UHDGWKLVUHJLVWHUEHIRUHFKDQJLQJWKH&38PRGH ,1726(7B),4,1726(7B,54UHJLVWHUFDQEHXVHGWRJHWWKHKLJKHVWSULRULW\LQWHUUXSWZLWKRXW&38PRGHFKDQJH 2WKHUXVDJHVDUHVLPLODUWR,172))6(7 127( ,IWKHORZHVWLQWHUUXSWSULRULW\SULRULW\LVSHQGLQJWKH,172))6(7YDOXHZLOOEH[ 7KHUHVHWYDOXHZLOOWKHUHIRUHEHFKDQJHGWR[WREHGLIIHUHQWLDWHGIURPLQWHUUXSW SHQGLQJSULRULW\ 7DEOH,172))6(75HJLVWHU 5HJLVWHU ,172))6(7 ,1726(7B),4 ,1726(7B,54 2IIVHW$GGUHVV [ [ [ 5: 5 5 5 'HVFULSWLRQ ,QWHUUXSWRIIVHWUHJLVWHU ),4,QWHUUXSWRIIVHWUHJLVWHU ,54,QWHUUXSWRIIVHWUHJLVWHU 5HVHW9DOXH [ [ [ ,17(55837&21752//(5 .6&5,6&0,&52&21752//(5 ,17(558373(1',1*%<35,25,7<5(*,67(5 7KHLQWHUUXSWSHQGLQJE\SULRULW\UHJLVWHU,1731'35,FRQWDLQVLQWHUUXSWSHQGLQJELWVZKLFKDUHUHRUGHUHGE\WKH ,1735,QUHJLVWHUVHWWLQJV,1731'35,>@LVPDSSHGWRWKHLQWHUUXSWVRXUFHRIZKLFKHYHUELWLQGH[LVZULWWHQLQWR WKHSULRULW\ILHOGRIWKH,1735,QUHJLVWHUV 7KLVUHJLVWHULVXVHIXOIRUWHVWLQJ7RYDOLGDWHWKHLQWHUUXSWSHQGLQJE\SULRULW\YDOXH\RXFDQREWDLQWKHKLJKHVW SULRULW\SHQGLQJLQWHUUXSWIURPWKHLQWHUUXSWRIIVHWUHJLVWHU,172))6(7 7DEOH,1731'35,5HJLVWHU 5HJLVWHU ,1731'35, 2IIVHW$GGUHVV [ 5: 5 'HVFULSWLRQ ,QWHUUXSWSHQGLQJE\SULRULW\ 5HVHW9DOXH [ .6&5,6&0,&52&21752//(5 ,17(55837&21752//(5 ,17(558373(1',1*7(675(*,67(5 7KHLQWHUUXSWSHQGLQJWHVWUHJLVWHU,1731'767LVXVHGWRVHWRUFOHDU,1731'DQG,1731'35,,IXVHUZULWHV GDWDWRWKLVUHJLVWHULWLVZULWWHQLQWRERWKWKH,1731'UHJLVWHUDQG,1731'35,UHJLVWHU7KHLQWHUUXSWSHQGLQJWHVW UHJLVWHU,1731'767LVDOVRXVHIXOIRUWHVWLQJ )RU,1731'WKHVDPHELWSRVLWLRQLVXSGDWHGZLWKWKHQHZFRPPLQJGDWD)RU,1731'35,WKHPDSSLQJELW SRVLWLRQE\,1735,QUHJLVWHUVLVXSGDWHGZLWKWKHQHZFRPPLQJGDWDWRNHHSZLWKWKHFRQWHQWVRIWKH,1731' UHJLVWHU 7DEOH,1731'7675HJLVWHU 5HJLVWHU ,1731'767 2IIVHW$GGUHVV [& 5: : 'HVFULSWLRQ ,QWHUUXSWSHQGLQJWHVWUHJLVWHU 5HVHW9DOXH [ ,17(55837&21752//(5 .6&5,6&0,&52&21752//(5 127(6 .6&5,6&0,&52&21752//(5 (/(&75,&$/'$7$ 6\PERO 9''9''$ 9,1 ,,1 7235 767* (/(&75,&$/'$7$ 7KLVFKDSWHUGHVFULEHVWKH.6&HOHFWULFDOGDWD $%62/87(0$;,0805$7,1*6 7DEOH$EVROXWH0D[LPXP5DWLQJV 3DUDPHWHU 6XSSO\YROWDJH '&LQSXWYROWDJH '&LQSXWFXUUHQW 2SHUDWLQJWHPSHUDWXUH 6WRUDJHWHPSHUDWXUH WR 9,2 9WROHUDQW r WR WR WR9'' WR P$ q& q& 5DWLQJ 8QLW 9 9 5(&200(1'('23(5$7,1*&21',7,216 7DEOH5HFRPPHQGHG2SHUDWLQJ&RQGLWLRQV 6\PERO 9''9''$ I26& /) 7$ 6XSSO\YROWDJH 2VFLOODWRUIUHTXHQF\ ([WHUQDO/RRS)LOWHU&DSDFLWDQFH &RPPHUFLDOWHPSHUDWXUH 3DUDPHWHU WR WR WR 5DWLQJ 8QLW 9 0+] S) q& 127( ,WLVVWURQJO\UHFRPPHQGHGWKDWDOOWKHVXSSO\SLQV9''9''$EHSRZHUHGIURPWKHVDPHVRXUFHWRDYRLGSRZHU ODWWFKXS (/(&75,&$/'$7$ .6&5,6&0,&52&21752//(5 '&(/(&75,&$/&+$5$&7(5,67,&6 7DEOH'&(OHFWULFDO&KDUDFWHULVWLFV 9'' 9r99(;7 r97$ WRq&LQFDVHRI9WROHUDQW,2 6\PERO 9,+ 9,/ 97 97 97 ,,+ 3DUDPHWHU +LJKOHYHOLQSXWYROWDJH /RZOHYHOLQSXWYROWDJH 6ZLWFKLQJWKUHVKKROG 6FKPLWWWULJJHUSRVLWLYHJRLQJWKUHVKROG 6FKPLWWWULJJHUQHJDWLYHJRLQJWKUHVKROG +LJKOHYHOLQSXWFXUUHQW ,QSXWEXIIHU ,QSXWEXIIHUZLWK SXOOXS ,,/ /RZOHYHOLQSXWFXUUHQW ,QSXWEXIIHU ,QSXWEXIIHUZLWK SXOOXS 92+ +LJKOHYHORXWSXWYROWDJH 7\SH%WR% ,2+ P$ 7\SH% 7\SH% 7\SH% 7\SH% 92/ /RZOHYHORXWSXWYROWDJH ,2+ P$ ,2+ P$ ,2+ P$ ,2+ P$ 9 9,1 966 /9&026 LQWHUIDFH /9&026 LQWHUIDFH /9&026 /9&026 /9&026 9,1 9'' 9'' 9 P$ P$ &RQGLWLRQ 0LQ 7\S 0D[ 8QLW 9 9 9 7\SH%WR% ,2/ P$ 7\SH% 7\SH% 7\SH% 7\SH% ,2/ P$ ,2/ P$ ,2/ P$ ,2/ P$ 9287 966RU 9'' 9'' 9 I0&/. 0+] ,2= ,'' 7ULVWDWHRXWSXWOHDNDJHFXUUHQW 0D[LPXPRSHUDWLQJFXUUHQW P$ P$ 127(6 $OO9WROHUDQWLQSXWVKDYHOHVVWKDQ9K\VWHULVLV 7\SH%PHDQVP$RXWSXWGULYHUFHOOVDQG7\SH%%PHDQVP$P$RXWSXWGULYHUFHOOV .6&5,6&0,&52&21752//(5 (/(&75,&$/'$7$ $&(/(&75,&$/&+$5$&7(5,67,&6 7DEOH$&(OHFWULFDO&KDUDFWHULVWLFV 7D q&WRq&9'' 9WR9 6LJQDO1DPH W(0] W(05V W(05K W(0$U W(0$I W$''5K W$''5G W15&6 W152( W1:%( W5'K W:'G W:'K W15$6I W15$6U W1&$6I W1&$6U W1':( W1'2( W1(&6 W:''G W:''K W:V W:K W0&/.2G 'HVFULSWLRQ 0HPRU\FRQWUROVLJQDO+LJK=WLPH ([W05(4VHWXSWLPH ([W05(4KROGWLPH ([W0$&.ULVLQJHGJHGHOD\WLPH ([W0$&.IDOOLQJHGJHGHOD\WLPH $GGUHVVKROGWLPH $GGUHVVGHOD\WLPH 52065$0)ODVKEDQNFKLSVHOHFWGHOD\WLPH 52065$0RUH[WHUQDO,2EDQNRXWSXWHQDEOHGHOD\ 52065$0RUH[WHUQDO,2EDQNZULWHE\WHHQDEOHGHOD\ 5HDGGDWDKROGWLPH :ULWHGDWDGHOD\WLPH65$0RUH[WHUQDO,2 :ULWHGDWDKROGWLPH65$0RUH[WHUQDO,2 '5$0URZDGGUHVVVWUREHDFWLYHGHOD\ '5$0URZDGGUHVVVWUREHUHOHDVHGHOD\ '5$0FROXPQDGGUHVVVWUREHDFWLYHGHOD\ '5$0&$6VLJQDOUHOHDVHGHOD\WLPH '5$0EDQNZULWHHQDEOHGHOD\WLPH '5$0EDQNRXWHQDEOHGHOD\WLPH ([WHUQDO,2EDQNFKLSVHOHFWGHOD\WLPH '5$0ZULWHGDWDGHOD\WLPH'5$0 '5$0ZULWUHGDWDKROGWLPH'5$0 ([WHUQDOZDLWVHWXSWLPH ([WHUQDOZDLWKROGWLPH ([WHUQDOFORFNWR0&/.2GHOD\WLPHZKHQ3//SRZHUGRZQ 0LQ 0D[ 8QLW QV (/(&75,&$/'$7$ .6&5,6&0,&52&21752//(5 127(6 .6&5,6&0,&52&21752//(5 0(&+$1,&$/'$7$ 0(&+$1,&$/'$7$ 3$&.$*('(0(16,216 7KLVVHFWLRQGHVFULEHVWKHPHFKDQLFDOGDWDIRUWKH.6&VSLQ4)3SDFNDJH %6& %6& %6& %6& 4)3% 0$; %6& 0$; 127('LPHQVLRQVDUHLQPLOOLPHWHUV 0,1 0$; )LJXUH4)3%3DFNDJH'LPHQVLRQV 0(&+$1,&$/'$7$ .6&5,6&0,&52&21752//(5 127(6 .6&5,6&0,&52&21752//(5 $33(1',;$ $33(1',;$ 7(67$&&(663257 7KLVVHFWLRQGHVFULEHVUHOHYHQWVHFWLRQVRIWKH,(((6WDQGDUG&RPSDWLEOH7HVW$FFHVV3RUW7$37KLV VWDQGDUGDSSOLHVWRWKH7HVW$FFHVV3RUWDQG%RXQGDU\6FDQ-7$*VSHFLILFDWLRQZKLFKLVVXSSRUWHGE\WKH .6&PLFURFRQWROOHU ,QWHVWPRGHSDFNDJHSDGVDUHPRQLWRUHGE\WKHVHULDOVFDQFLUFXLWU\7KLVLVGRQHWRVXSSRUWFRQQHFWLYLW\WHVWLQJ GXULQJPDQXIDFWXULQJDVZHOODVV\VWHPGLDJQRVWLFV-7$*FRQWUROLVQRWXVHGWRGULYHLQWHUQDOGDWDRXWRIWKH .6& 7RFRQIRUPZLWK,(((WKH.6&KDVD7$3FRQWUROOHUDQLQVWUXFWLRQUHJLVWHUDE\SDVVUHJLVWHUDQG DQ,'UHJLVWHU7KHVHFRPSRQHQWVDUHGHVFULEHGLQGHWDLOEHORZ $ $33(1',;$ .6&5,6&0,&52&21752//(5 7$3&21752//(5 7KH7$3FRQWUROOHULVUHVSRQVLEOHIRULQWHUSUHWLQJWKHVHTXHQFHRIORJLFDOYDOXHVRQWKH706VLJQDO,WLVD V\QFKURQRXVVWDWHPDFKLQHZKLFKFRQWUROVWKH-7$*ORJLFVHH)LJXUH%,Q)LJXUH%WKHYDOXHVKRZQQH[WWR HDFKFXUYHGDUURZUHSUHVHQWVWKHYDOXHRIWKH706VLJQDODVLWLVVDPSOHGRQWKHULVLQJHGJHRIWKH7&.VLJQDO 7(67/2*,15(6(7 5817(67,'/( 6(/(&7'5B6&$1 &$3785('5 6+,)7'5 (;,7'5 3$86('5 (;,7'5 83'$7('5 6(/(&7,5B6&$1 &$3785(,5 6+,)7,5 (;,7,5 3$86(,5 (;,7,5 83'$7(,5 )LJXUH$7$3&RQWUROOHU6WDWH0DFKLQH $ .6&5,6&0,&52&21752//(5 $33(1',;$ %281'$5<6&$15(*,67(5 7KH.6&VFDQFKDLQLPSOHPHQWDWLRQXVHVDELWERXQGDU\VFDQUHJLVWHU7KLVUHJLVWHUFRQWDLQVELWVIRU DOOGHYLFHVLJQDOVDQGFORFNSLQVDQGIRUDVVRFLDWHGFRQWUROVLJQDOV $OOELGLUHFWLRQDOSLQVKDYHWZRUHJLVWHUELWVLQWKHERXQGDU\VFDQUHJLVWHUIRUSLQGDWD(DFKSLQLVFRQWUROOHGE\DQ DVVRFLDWHGFRQWUROELWLQWKHERXQGDU\VFDQUHJLVWHU7KHWZHQW\WKUHHELWVLQWKHERXQGDU\VFDQUHJLVWHUGHILQHWKH RXWSXWHQDEOHVLJQDOVIRUDVVRFLDWHGJURXSVRIELGLUHFWLRQDODQGWULVWDWHDEOHSLQV7KHFRQWUROELWVDQGWKHLUELW SRVLWLRQVDUHOLVWHGLQ7DEOH% 7DEOH$%RXQGDU\6FDQ&RQWURO%LWV 1DPH SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ %LW1XPEHU 1DPH SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ %LW1XPEHU 1DPH SHQE>@ SHQE>@ GBHQE GLVBEXV PGLRBRH W[FEHQ W[FDHQ %LW1XPEHU %281'$5<6&$1'(),1,7,216 7KHERXQGDU\VFDQELWGHILQLWLRQVDUHOLVWHGLQ7DEOHV%WKURXJK% 7KHILUVWFROXPQLQWKHWDEOHGHILQHVWKHELWVRUGLQDOSRVLWLRQLQWKHERXQGDU\VFDQUHJLVWHU7KHVKLIWUHJLVWHU FHOOQHDUHVW7'2WKDWLVWKHILUVWELWWREHVKLIWHGRXWLVGHILQHGDVELW7KHODVWELWWREHVKLIWHGRXWLVELW QXPEHU 7KHVHFRQGFROXPQUHIHUVWRRQHRIWKHIRXU.6&FHOOW\SHVMWLQMWELDQGMWRXW 7KHWKLUGFROXPQOLVWVWKHSLQQDPHRISLQUHODWHGFHOOVRUGHILQHVWKHQDPHRIELGLUHFWLRQDOFRQWUROUHJLVWHUELWV 7KHIRXUWKFROXPQOLVWVWKHSLQW\SH762XWSXWLQGLFDWHVDWULVWDWHDEOHRXWSXWSLQDQG2',2GHQRWHVDQ RSHQGUDLQELGLUHFWLRQDOSLQ 7KHILIWKFROXPQLQGLFDWHVWKHDVVRFLDWHGERXQGDU\VFDQUHJLVWHUFRQWUROELWIRUELGLUHFWLRQDOWULVWDWHRXWSXW $ $33(1',;$ .6&5,6&0,&52&21752//(5 SLQV 7DEOH$%RXQGDU\6FDQ'HILQLWLRQV3DJH %LW 1XPEHU &HOO 7\SH MWLQ MWRXW MWRXW MWLQ MWLQ MWEL MWEL MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL 3LQ&HOO 1DPH 8$5;' Q8$'65 8$7;' 8$'75 8$5;' 6'$ 6'$ 6&/ 6&/ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3LQ 7\SH ,QSXW 2XWSXW 2XWSXW ,QSXW ,QSXW 2'2XWSXW 2',QSXW 2'2XWSXW 2',QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW 2XWSXW &7/&HOO SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ %LW 1XPEHU &HOO 7\SH MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWRXW MWEL MWEL MWEL 3LQ&HOO 1DPH 3>@ SHQE>@ 3>@R 3>@L SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@ 3>@ SHQE>@ 3>@R 3>@L SHQE>@ 3>@ 3>@ ;'$7$>@ 3LQ 7\SH ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW 2XWSXW &7/&HOO SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ SHQE>@ GHQE $ .6&5,6&0,&52&21752//(5 $33(1',;$ 7DEOH$%RXQGDU\6FDQ'HILQLWLRQV3DJH %LW 1XPEHU &HOO 7\SH MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL 3LQ&HOO 1DPH ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ 3LQ 7\SH ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW 2XWSXW &7/&HOO GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE %LW 1XPEHU &HOO 7\SH MWEL MEWL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWEL MWRXW 3LQ&HOO 1DPH ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ ;'$7$>@ GHQE 3LQ 7\SH ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 762XWSXW ,QSXW 2XWSXW &7/&HOO GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE GHQE $ $33(1',;$ .6&5,6&0,&52&21752//(5 7DEOH$%RXQGDU\6FDQ'HILQLWLRQV3DJH %LW 1XPEHU &HOO 7\SH MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWLQ MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW 3LQ&HOO 1DPH 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ 3$''5>@ (;70$&. (;705(4 Q:%(>@ Q:%(>@ Q:%(>@ Q:%(>@ Q':( Q&$6>@ Q&$6>@ Q&$6>@ 3LQ 7\SH 762 762 762 762 762 762 762 762 762 762 762 762 762 762 762 762 762 762 762 762 762 762 2XWSXW 762 762 762 762 762 762 762 762 762 2XWSXW &7/&HOO GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV %LW 1XPEHU &HOO 7\SH MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWRXW MWLQ MWLQ MWFN MWRXW MWLQ MWRXW MWLQ MWLQ MWRXW MWLQ MWRXW MWRXW MWRXW MWRXW MWRXW MWLQ MWLQ MWRXW MWLQ MWRXW MWEL MWEL 3LQ&HOO 1DPH Q&$46>@ Q5$6>@ Q5$6>@ Q5$6>@ Q5$6>@ Q5&6>@ Q5&6>@ Q5&6>@ Q5&6>@ Q5&6>@ &/.6(/ Q5(6(7 0&/. 0&./2 &/.2(1 Q5&6>@ %6,=(>@ %6,=(>@ Q2( Q(:$,7 Q(&6>@ Q(&6>@ Q(&6>@ Q(&6>@ GLVBEXV 8&/. 702'( 0'& /,77/( PGLRBRH 0',2 0',2 3LQ 7\SH 762 762 762 762 762 762 762 762 762 762 ,QSXW ,QSXW ,QSXW 2XWSXW ,QSXW 762 ,QSXW ,QSXW 762 ,QSXW 762 762 762 762 ,QSXW ,QSXW 2XWSXW 762 ,QSXW 2XWSXW &7/&HOO GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV GLVBEXV PGLRBRH $ .6&5,6&0,&52&21752//(5 $33(1',;$ 7DEOH$%RXQGDU\6FDQ'HILQLWLRQV3DJH %LW 1XPEHU &HOO 7\SH MWRXW MWLQ MWRXW MWRXW MWRXW MWRXW MWRXW MWLQ MWLQ MWLQ MWLQ MWLQ MWLQ MWLQ MWLQ MWLQ MWRXW MWEL MWEL MWRXW MWLQ MWLQ MWLQ MWRXW MWRXW MWLQ 3LQ&HOO 1DPH 7;B(1 7;(1B0 7;B&/. 7;&/.B0 7;B(55 3&203B0 7;' 7;' 7;' /223 7;' 7;'B0 &2/ &2/B0 5;B&/. 5;&/.B0 5;B(55 5;' 5;' 5;' 5;' 5;'B0 5;B'9 /,1. &56 &56B0 W[FEHQ 7;&% 7;&% Q6<1&% 5;&% Q'&'% Q&76% 7;'% Q576% 5;'% 3LQ 7\SH 2XWSXW ,QSXW 2XWSXW 2XWSXW 2XWSXW 2XWSXW 2XWSXW ,QSXW ,QSXW ,QSXW ,QSXW ,QSXW ,QSXW ,QSXW ,QSXW ,QSXW 762XW ,QSXW 2XWSXW ,QSXW ,QSXW ,QSXW 2XWSXW 2XWSXW ,QSXW 2XWSXW &7/&HOO %LW 1XPEHU &HOO 7\SH MWRXW MWRXW MWEL MWEL MWRXW MWLQ MWLQ MWLQ MWRXW MWRXW MWLQ MWRXW MWRXW MWRXW MWLQ 3LQ&HOO 1DPH Q'75% W[FDHQ 7;&$ 7;&$ Q6<1&$ 5;&$ Q'&'$ Q&76$ 7;'$ Q576$ 5;'$ Q'75$ Q8$'65 8$7;' 8$'75 3LQ 7\SH 2XWSXW 2XWSXW ,QSXW 2XWSXW ,QSXW ,QSXW ,QSXW 2XWSXW 2XWSXW ,QSXW 2XWSXW 2XWSXW 2XWSXW ,QSXW 2XWSXW &7/&HOO W[FDHQ W[FEHQ $ $33(1',;$ .6&5,6&0,&52&21752//(5 -7%, -7,1 6+,)7 ',131 7'2 7', 08; ' 4 ' 4 08; '287 6(71 02'( -7287 ',13 7'2 08; ' 4 ' 4 08; '287 02'( 7', 7&. 83'$7( -7&. 6+,)7 7', 08; 7&. ' 4 7'2 )LJXUH$.6&6FDQ&HOOV $ .6&5,6&0,&52&21752//(5 $33(1',;$ ,16758&7,215(*,67(5 7KHLQVWUXFWLRQUHJLVWHULVIRXUELWVLQOHQJWK7KHUHLVQRSDULW\ELW7KHIL[HGYDOXHLVORDGHGLQWRWKH LQVWUXFWLRQUHJLVWHUGXULQJWKH&$3785(,5FRQWUROOHUVWDWH 7KH7$3PDFKLQHVVXSSRUWVWKHIROORZLQJSXEOLFLQVWUXFWLRQV+RZHYHUWKH.6&ERXQGDU\VFDQORJLFRQO\ VXSSRUWV(;7(67,'&2'(%<3$66DQG6$03/(35(/2$'LQVWUXFWLRQV7KHUHPDLQLQJLQVWUXFWLRQVDUHXVHG IRU$507'0,FRUHWHVWLQJDQGGHEXJJLQJ 7DEOH$3XEOLF,QVWUXFWLRQV ,QVWUXFWLRQ (;7(67 6&$1B1 ,17(67 ,'&2'( %<3$66 &/$03 +,*+= &/$03= 6$03/(35(/2$' 5(67$57 %LQDU\&RGH $ $33(1',;$ .6&5,6&0,&52&21752//(5 6DPVXQJ(OHFWURQLFV&R .6&%6'/ 9HUVLRQ 5HYLVLRQ/LVW 3LQQDPH1&FKDQJHGWR/,77/( ! 3DFNDJH7\SH4)3% HQWLW\.6&LV JHQHULF3+<6,&$/B3,1B0$3VWULQJ 4)3% SRUW Q8$'75 8$7;' Q8$'65 Q'75$ 5;'$ Q576$ 7;'$ Q&76$ Q'&'$ 5;&$ Q6<1&$ 7;&$ Q'75% 5;'% Q576% 7;'% Q&76% Q'&'% 5;&% Q6<1&% 7;&% &56B&56B0 5;B'9B/,1. 5;' 5;B(55 5;B&/.B5;&/.B0 &2/B&2/B0 7;' 7;B(55B3&203B0 7;B&/.B7;&/.B0 7;B(1B7;(1B0 LQELW RXWELW RXWELW RXWELW LQELW RXWELW RXWELW LQELW LQELW LQELW RXWELW LQRXWELW RXWELW LQELW RXWELW RXWELW LQELW LQELW LQELW RXWELW LQRXWELW LQELW LQELW LQELWBYHFWRUWR LQELW LQ ELW LQELW RXWELWBYHFWRUWR RXWELW LQ ELW RXWELW $ .6&5,6&0,&52&21752//(5 $33(1',;$ 0',2 /,77/( 0'& 7&. 706 7', 7'2 Q7567 702'( 8&/. Q(&6 Q(:$,7 Q2( %6,=( &/.2(1 0&/.2 0&/. Q5(6(7 &/.6(/ Q5&6 Q5$6 Q&$6 Q':( Q:%( ([W05(4 ([W0$&. $''5 ;'$7$ 3 6&/ 6'$ 8$5;' Q8$'75 8$7;' Q8$'65 8$5;' 9''3 9'', 9663 966, LQRXWELW LQELW RXWELW LQELW LQELW LQELW RXWELW LQELW LQELW LQELW RXWELWBYHFWRUWR LQELW RXWELW LQELWBYHFWRUWR LQELW RXWELW LQELW LQELW LQELW RXWELWBYHFWRUWR RXWELWBYHFWRUWR RXWELWBYHFWRUWR RXWELW RXWELWBYHFWRUWR LQELW RXWELW RXWELWBYHFWRUWR LQRXWELWBYHFWRUWR LQRXWELWBYHFWRUWR LQRXWELW LQRXWELW LQELW LQELW RXWELW RXWELW LQELW OLQNDJHELWBYHFWRUWR OLQNDJHELWBYHFWRUWR OLQNDJHELWBYHFWRUWR OLQNDJHELWBYHFWRUWR $ $33(1',;$ .6&5,6&0,&52&21752//(5 XVH67'BBBDOO DWWULEXWH3,1B0$3RI.6&HQWLW\LV3+<6,&$/B3,1B0$3 4)3%3LQ0DS 1RFRQQHFWV FRQVWDQW4)3%3,1B0$3B675,1* Q8$'75 8$7;' Q8$'65 Q'75$ 5;'$ Q576$ 7;'$ Q&76$ Q'&'$ 5;&$ Q6<1&$ 7;&$ Q'75% 5;'% Q576% 7;'% Q&76% Q'&'% 5;&% Q6<1&% 7;&% &56B&56B0 5;B'9B/,1. 5;' 5;B(55 5;B&/.B5;&/.B0 &2/B&2/B0 7;' 7;B(55B3&203B0 7;B&/.B7;&/.B0 7;B(1B7;(1B0 0',2 /,77/( 0'& $ .6&5,6&0,&52&21752//(5 $33(1',;$ 7&. 706 7', 7'2 Q7567 702'( 8&/. Q(&6 Q(:$,7 Q2( %6,=( &/.2(1 0&/.2 0&/. Q5(6(7 3&/.6(/ Q5&6 Q5$6 Q&$6 Q':( Q:%( ([W05(4 ([W0$&. $$$$$$$$$$$$$$$$$$$$$$ $''5 ''''''''''''''''''''' ''''''''''' ;'$7$ 333333333333333333 3 6&/ 6'$ 8$5;' Q8$'75 8$7;' Q8$'65 8$5;' 9''3 9'', 9663 966, $ $33(1',;$ .6&5,6&0,&52&21752//(5 DWWULEXWH7$3B6&$1B,1RI7',VLJQDOLVWUXH DWWULEXWH7$3B6&$1B287RI7'2VLJQDOLVWUXH DWWULEXWH7$3B6&$1B02'(RI706VLJQDOLVWUXH DWWULEXWH7$3B6&$1B5(6(7RIQ7567VLJQDOLVWUXH DWWULEXWH7$3B6&$1B&/2&.RI7&.VLJQDOLVWUXH DWWULEXWH,16758&7,21B/(1*7+RI.6&HQWLW\LV DWWULEXWH,16758&7,21B23&2'(RI.6&HQWLW\LV (;7(67 6&$1B1 ,17(67 ,'&2'( %<3$66 &/$03 +,*+= &/$03= 6$03/( 5(67$57 .6&V,'&2'(LVWKH$507'0,V,'&2'( DWWULEXWH5(*,67(5B$&&(66RI.6&HQWLW\LV YHUVLRQ GHVLJQFHQWHU VHTXHQFHQXPEHU 6DPVXQJ UHTXLUHGE\ DWWULEXWH5(*,67(5B$&&(66RI.6&HQWLW\LV ,'&2'(,'&2'( %281'$5<,17(676$03/((;7(67 %<3$66&/$03+,*+=%<3$66 DWWULEXWH%281'$5<B&(//6RI.6&HQWLW\LV%&B%&B%&B DWWULEXWH%281'$5<B/(1*7+RI.6&HQWLW\LV DWWULEXWH%281'$5<B5(*,67(5RI.6&HQWLW\LV QXPFHOOSRUWIXQFWLRQVDIH>FFHOOGLVYDOUVOW@ %&B8$5;'LQSXW; %&BQ8$'65RXWSXW; %&B8$7;'RXWSXW; %&BQ8$'75LQSXW; %&B8$5;'LQSXW; %&B6'$RXWSXW=2SHQGUDLQ2XWSXW $ .6&5,6&0,&52&21752//(5 $33(1',;$ %&B6'$LQSXW; %&B6&/RXWSXW=2SHQGUDLQ2XWSXW %&B6&/LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= $ $33(1',;$ .6&5,6&0,&52&21752//(5 %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&BFRQWUROU3B(1% %&B3RXWSXW;= %&B3LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; $ .6&5,6&0,&52&21752//(5 $33(1',;$ %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; $ $33(1',;$ .6&5,6&0,&52&21752//(5 %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&B;'$7$RXWSXW;= %&B;'$7$LQSXW; %&BFRQWUROU'$7$287B(1% %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= %&B$''5RXWSXW;= $ .6&5,6&0,&52&21752//(5 $33(1',;$ %&B$''5RXWSXW;= %&B([W0$&.RXWSXW; %&B([W05(4LQSXW; %&BQ:%(RXWSXW;= %&BQ:%(RXWSXW;= %&BQ:%(RXWSXW;= %&BQ:%(RXWSXW;= %&BQ':(RXWSXW;= %&BQ&$6RXWSXW;= %&BQ&$6RXWSXW;= %&BQ&$6RXWSXW;= %&BQ&$6RXWSXW;= %&BQ5$6RXWSXW;= %&BQ5$6RXWSXW;= %&BQ5$6RXWSXW;= %&BQ5$6RXWSXW;= %&BQ5&6RXWSXW;= %&BQ5&6RXWSXW;= %&BQ5&6RXWSXW;= %&BQ5&6RXWSXW;= %&BQ5&6RXWSXW;= %&B&/.6(/LQSXW; %&BQ5(6(7LQSXW; %&B0&/.LQSXW; %&B0&/.2RXWSXW; %&B&/.2(1LQSXW; %&BQ5&6RXWSXW;= %&B%6,=(LQSXW; %&B%6,=(LQSXW; %&BQ2(RXWSXW;= %&BQ(:$,7LQSXW; %&BQ(&6RXWSXW;= %&BQ(&6RXWSXW;= %&BQ(&6RXWSXW;= %&BQ(&6RXWSXW;= %&BFRQWUROU',6B%86 %&B8&/.LQSXW; %&B702'(LQSXW; $ $33(1',;$ .6&5,6&0,&52&21752//(5 %&B0'&RXWSXW; %&B/,77/(LQSXW; %&BFRQWUROU0',2B2( %&B0',2RXWSXW;= %&B0',2LQSXW; %&B7;B(1B7;(1B0RXWSXW; %&B7;B&/.B7;&/.B0LQSXW; %&B7;B(55B3&203B0RXWSXW; %&B7;'RXWSXW; %&B7;'RXWSXW; %&B7;'B/223RXWSXW; %&B7;'B7;'B0RXWSXW; %&B&2/B&2/B0LQSXW; %&B5;B&/.B5;&/.B0LQSXW; %&B5;B(55LQSXW; %&B5;'LQSXW; %&B5;'LQSXW; %&B5;'LQSXW; %&B5;'B5;'B0LQSXW; %&B5;B'9B/,1.LQSXW; %&B&56B&56B0LQSXW; %&BFRQWUROU7;&%(1 %&B7;&%RXWSXW;= %&B7;&%LQSXW; %&BQ6<1&%RXWSXW; %&B5;&%LQSXW; %&BQ'&'%LQSXW; %&BQ&76%LQSXW; %&B7;'%RXWSXW; %&BQ576%RXWSXW; %&B5;'%LQSXW; %&BQ'75%RXWSXW; %&BFRQWUROU7;&$(1 %&B7;&$RXWSXW;= %&B7;&$LQSXW; %&BQ6<1&$RXWSXW; %&B5;&$LQSXW; %&BQ'&'$LQSXW; %&BQ&76$LQSXW; %&B7;'$RXWSXW; %&BQ576$RXWSXW; %&B5;'$LQSXW; %&BQ'75$RXWSXW; %&BQ8$'65RXWSXW; %&B8$7;'RXWSXW; %&BQ8$'75LQSXW; HQG.6& $ .6&5,6&0,&52&21752//(5 $33(1',;% $33(1',;% 61'66$0681*1(7$50'(9(/230(176<67(0 6&+(0$7,&$1'%2$5'/$<287 7KH61'6ERDUGVFKHPDWLFVFRQVLVWRIWHQSDJHV7KHFRQWHQWRIHDFKSDJHLVEULHIO\GHVFULEHGEHORZ 3DJH0$,1 'HVFULSWLRQRIHDFKVFKHPDWLF 3DJH'5$0 2QHEDQNIRU('2'5$0SLQ6,00'5$00RGXOH.00 2QHEDQNIRU6'5$0.06%0[ELW[EDQN 3DJH(7+(51(7 0ESV(WKHUQHW,QWHUIDFH0,, 3K\VLFDO,QWHUIDFH3+<0DJQHWLF 5-DGDSWRUVLGHSLQFRQILJXUDWLRQ5- 3DJH(;7(51$/ *HQHUDO,2SRUWV 8VHUGHILQHGFRQWUROVZLWFKDQGVWDWXV/(' /&'GULYHULQWHUIDFH ,&((3520 3DJH+'/& 7ZRFKDQQHOVHULDOFRPPXQLFDWLRQSRUW '68%SLQLQWHUIDFH 3DJH0&8 .6&.6&1HW$50 3UREHKHDGHU 3DJH520 7ZRERRW520VRFNHWV 520'DWDVL]HLVFRQILJXUHGE\%6,=(>@VHOHFWVZLWFK )ODVK520VXSSRUW 3DJH65$0 2QHEDQN65$0 )RXUE\WHVL]H % $33(1',;% .6&5,6&0,&52&21752//(5 3DJH6<67(0 3RZHU 5HVHW &ORFN -7$*SRUW &RQWUROVZLWFK 6\VWHPVWDWXV/(' 3DJH8$57 7ZRFKDQQHO6HULDOSRUWV '68%FRQQHFWRULQWHUIDFH 2QHIRUFRQVRO % KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C Appendix C ABOUT SNDS100 BOARD C.1 SYSTEM OVERVIEW SNDS100 Board Overview Features C.2 CIRCUIT DESCRIPTION Power Supply Clock Source And Distribution Reset Logic Boot ROM/FLASH ROM Dram Banks Status LCD Driver General I/O Ports Serial Ports Serial Communication Interface Ethernet Interface EmbeddedICE Interface C.3 BOARD CONFIGURATION AND STATUS Setting System Power Setting System Clock Selection Setting HDLC External Test Setting DIP Switch for System Configuration Setting PLL Selection Setting UCLK Setting SRAM/EXT I/O bank Selection Setting DRAM/SRAM Chip Selection Setting MII Interface Status LED For KS32C50100 Mode User Control/Status Example Of SNDS100 Configuration Setting C.4 THE SNDS100 PROGRAMMER's MODEL BASIC Overview Memory System DRAM Area Structure Writing A ROM Code Interrupt Handling C.5 EMBEDDED-ICE INTERFACE What Is EmbeddedICE ? Communicating With EmbeddedICE C-1 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C C.1 SYSTEM OVERVIEW SNDS100(Samsung NetARM Development System 100) is a platform that is suitable for code development of SAMSUNG's KS32C50100 16/32-bit RISC microcontroller(NetARM-II) for Ethernet-based system. Also it supports a development of KS32C5000(NetARM-I) in a similar way as SNDS do. KS32C50100(KS32C5000) consists of 16-/32-bit RISC(ARM7TDMI) CPU core, 8-Kbyte unified cache/SRAM, I C-bus controller, Ethernet controller with 2-channel buffered DMA, 2 HDLC with 4-channel buffered DMA, 2-channel GDMA, 2 UARTs, two 32-bit timers, 18 programmable I/O ports, interrupt controller, and a system manager. it also supports JTAG boundary scan for the application system testing. SNDS100 consists of KS32C50100(KS32C5000) , boot EEPROM(Flash ROM), DRAM module, SDRAM, serial ports for consol, two serial communication ports, ethernet interface, configuration switchs, and status LEDs/LCD. The Ethernet interface has a complete IEEE802.3 physical layer interface with ethernet hub/ router side RJ45 connector configuration. 2 SNDS100 BOARD OVERVIEW The SNDS100 shows the basic system-based hardware design which uses the KS32C50100(KS32C5000) . It can evaluate the basic operations of the KS32C50100(KS32C5000) and develope codes for it as well. When the KS32C50100(KS32C5000) is contained in the SNDS100 , you can use an in-circuit emulator(ICE). This allows you to test and debug a system design at the processor level. In addition, the KS32C50100 TM (KS32C5000) with embeddedICE capability can be debugged directly using the EmbeddedICE Interface. The SNDS100 function blocks are shown in Figure C-1. NetARM-I/NetARM-II 8KByte unified Cache/SRAM GDMAC (2-Channel) System Manager ROM/SRAM SDRAM DRAM External Master/ General I/O ARM7TDMI 32bit RISC CPU CPU Interface Timer Interrupt Controller TAP Contoller (JTAG) UART I2C HDLC (2-Ch) Ethernet Controller (10/100M) Boot ROM SDRAM DRAM 2-bank SIMM Status LED Control S/W LCD Drv. SIO Console I2C EEPROM Serial Comm. I/F Ethernet PHY I/F Embedded ICE I/F Figure C-1 SNDS100 Block Diagram C-2 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C FEATURES KS32C50100( or KS32C5000 ) : 16/32-bit RISC microcontroller Boot ROM : 512K bit, 1M bit, 4M bit, support byte, half-word, word size boot ROM DRAM : 72-pin SIMM module with two banks and EDO DRAM support SDRAM : Two 4Mx16 with 2banks SDRAM support External I/O : status LCD driver General I/O : control switchs and status display LED Two serial ports, one for console I2C-bus EEPROM Two-channel serial communication interface 10/100Mbps Ethernet interface TM EmbeddedICE Interface C-3 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C C.2 CIRCUIT DESCRIPTION SNDS100 board consists of logic components, several control/status display block, and a debug interface block. SNDS100 board's detailed block diagram, and its components are shown in Figure C-3. POWER SUPPLY SNDS100 is designd to operate at 3.3V and 5V. Power to the SNDS100 is supplied through a DC jack power adaptor which supports the voltage between 6V and 9V and drives the current at least 850 mA . SNDS100 board has distributted power plane, with power going separately to the MCU and the main power plane. In case of KS32C5000, main power and MCU power has 5V level. But with KS32C50100, MCU power has 3.3V. For this reason, power jumpers J5,J6,J7 and J8 are inserted ( see Figure C-9 ) . Ground +6 to +9V (above 850 mA) Figure C-2 : Power Adaptor Power Adaptor Main Power Plane SNDS100 board DC JACK J5 MCU Power Plane J7 J6 NetARM-I/II (KS32C5000/ KS32C50100) J8 Figure C-3 : Power Plane C-4 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C Main Power Supply EmbeddedICE Interface Unit Power Supply OSC 10Mhz XCLK Reset Switch nRESET JTAG PORT JTAG Signal P[7:0] P[11:8] SNDS100 Board BootROM /FLASH (32-,16-bit) DRAM 2-Bnaks (72pin SIMM) SDRAM (32M-bit 2-bank) ADDR[21:0] XDATA[31:0] ROM0 Cntl ADDR[21:0] XDATA[31:0] DRAM0,1 Cntl SDRAM0,1 Cntl ADDR[21:0] XDATA[31:0] Probe Connector Probe Connector Ethernet I/F SIGNAL Status LED CNTL S/W LCD DRIVE Probe Connector ARM7TDMI (NetARM) nECS0 XDATA[7:0] UART I/F Signal MAX232 Probe Connector STATION Management SIGNAL HDLC I/F SIGNAL I2 C I/F SIGNAL OSC 25Mhz Ethernet Cntl/Status MAX PHY 232 PORT B PORT A Magnetic Adaptor SIDE CONFIGURATION RJ45 I2C DSUB 25 (2 EA) EEPROM DSUB 9 (2 EA) 10/100M Ethernet I/F Host PC SIO/CONSOL Figure C-4 : Detailed SNDS100 Board C-5 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C CLOCK SOURCE AND DISTRIBUTION The following clock source are supported System Clock (MCLK) and Internal Clock Select (CLKSEL) Table C-1 Configuring System Clock CLKSEL CLKSEL Signal Device Typical Use MCLK 33MHz "High" "Low" requirement CLKSEL = '0' and ext 33Mhz crystal oscillator. CLKSEL = '0' and ext 10Mhz crystal oscillator . KS32C5000 XCLK/2 XCLK (Ext Oscilltor) XCLK KS32C50100 PLL output 50MHz MCLK (Master Clock) System Clock Out (MCLKO) If CLKOEN(S2,2) is "1"(OFF), MCLKO is the same signal as the KS32C50100(KS32C5000) internal system clock. else MCLKO is "0". ( If you want to use SDRAM, MCLKO should be high. see Figure : 1-10 ) Ethernet control Clock (REF_IN) Used by Ethernet PHY control clock; generated by a 25MHz crystal oscillator. C-6 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C RESET LOGIC For a KS32C50100(KS32C5000) reset, nRESET must be held to low level at least 540 master clock cycles. BOOT ROM/FLASH ROM SNDS100 contains four byte DIP type ROM socket(U17,U18). You can use a bus size of 8,16, or 32 bits Table C-2 ROM Data Bus Size Selection ROM Data Bus Size Reserved Byte Half-word Word B0SIZE[1:0] 00 01 10 11 DRAM BANKS SNDS100 has not only one DRAM bank which has 72-pin SIMM module DRAM socket(U3) but also two SDRAM which has 32M bit 2-banks(U1,U2). In DRAM module, SNDS100 boot ROM code find out the type of memory which is installed and the size of this. Then initialize memory banks, base/end pointer and the timing of CAS/RAS during system power up. If DRAM banks are found, each bank can be configured as an EDO DRAM mode using the system management block DRAM bank control register. STATUS LCD DRIVER SNDS100 provide LCD display to indicate SNDS100 status. External I/O bank 0 is used to control the LCD driver. The LCD Driver interface connector pin numbers are descriped in Table C-3. Table C-3 LCD Driver Interface Connector Pin Numbers Pin No. 1 2 3 4 5 6 [14:7] GND VCC Description Resolution control A[1] A[0] Chip select DATA[7:0] C-7 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C GENERAL I/O PORTS KS32C50100(KS32C5000) 's general I/O ports is used for SNDS100 control and LED status display. The function of control switch and the status LED is user defined. Table C-4 General I/O Port Assignments General I/O Port No. P[11:8] P[7:0] I/O Type Input Output Description Control Input Status LED out SERIAL PORTS SNDS100 has two serial port(P2A,P2B). One port is used for console. 1 6 2 7 3 8 4 9 5 DB 9-pin Figure C-5 Serial Port Diagram 5 Gnd Pin No. 2 3 Description TxD RxD SERIAL COMMUNICATION INTERFACE KS32C50100(KS32C5000) has two high level data link controllers(HDLC) for serial communication. The SNDS100 supports two-channel serial communication port(P1A,P1B) with V.24/RS-232 interface . Pin No. 14 15 16 17 18 19 20 21 22 23 24 25 2 3 1 2 3 4 5 6 7 8 9 10 11 12 13 DB 25-pin 6 4 5 Description TxD RxD Gnd CTS DSR Pin No. 7 8 17 20 22 Description Gnd DCD RxC DTR TxC Figure C-6 Serial Communication Interface Diagram C-8 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C ETHERNET INTERFACE KS32C50100KS32C5000) has one 10-/100-Mbps Ethernet controller. SNDS100 supports 10-/100-Mbps Ethernet interface, A Phy chip set used in SNDS100 is able to operate 10-/100-M bps using autonegitiation and communicate with KS32C50100 using an MII interface. SNDS100 Ethernet connector(RJ45) has Ethernet adaptor side pin configuration. which supports communication between the SNDS100 and the host PC's NIC. You can connect SNDS100 to hub or router direct without twisting cable. One thing you have to do is setting the jumpers (J3-1,J3-2 refer to section 1-3) Both receive and transmit domains must be connected to the digital domain through a ferrite bead or inductor. The value of the inductor is from 0.1uH to 1uH. The PCB power plane and RJ45 connector(J1) configuration is shown in Figure C-7. MAIN DIGITAL DOMAIN 10/100M PHY RECEIVE DOMAIN KS32C50100 (KS32C5000) MAGNETIC RJ45 J1 TRANSMIT DOMAIN RJ45 Pin Configuration(Adaptor side) Pin No. 1 2 3 4 Figure C-7 Description CMT CT_T TX+ TXPin No. 5 6 7 8 Description NC CT_R RX+ RX- Ethernet Port Configuration C-9 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C EMBEDDED ICE INTERFACE SNDS100 debugging of the KS32C50100(KS32C5000) is controlled through the microcontroller's JTAG port using EmbeddedICE interface. The interface connector(JP10) is a 14-way box header(see Figure : 1-8). This plug is connected to the EmbeddedICE interface module using a short 14-way IDC cable with IDC sockets at each end. 2 1 4 3 6 5 8 7 10 9 12 11 14 13 Pin 1,13 3 5 7 9 11 12 2,4,6,8,10,14 Name SPU nTRST TDI TMS TCK TDO nICERST VSS Function Connected to VDD through 33 Ohm register Test Reset, Active Low Test Data In Test Mode Select Test Clock Test Data Out Un used System Ground Figure C-8 EmbeddedICE Interface Connector C-10 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C C.3 BOARD CONFIGURATION AND STATUS SETTING SYSTEM POWER SNDS100 board has a distributed power plane, an MCU-only power plane, and a main power plane. For normal operation, power jumpers J5,J6,J7 and J8 are inserted. J5 J6 J7 J8 1 2 3 J5 J6 J7 J8 1 2 3 J5 J6 J7 J8 1 2 3 3.3V MCU_PWR 5V (a) KS32C50100 (b) KS32C5000 Figure C-9 : Power Setting SETTING SYSTEM CLOCK SELECTION By setting switches and jumpers, it's easy to configure SNDS100 board as a use for KS32C50100 or KS 32C50100. 1 2 3 J2 J3 J4 MCU_PWR 1 2 1 2 3 J2 J3 J4 1 2 3 J2 J3 J4 GND 3 J2 J3 J4 (a) (b) (b) Use Ext OSC (c) (c) Use PLL with SDRA M CLKOEN CLKSEL TMOD Device J2 J3 (50100) Ext OSC clock MCLKO enabled (both) (5000) KS32C5000 (a) Use Ext OSC (b) Ext OSC divided by 2 (c) Only for KS32C50100 KS32C50100 (a) Use PLL 1-2 (Don't use) XCLK/2 2-3 Normal Ext OSC clock PLL output MCLKO disabled Note Fixed , 2-3 should be set According to device, a generated system clock has different frequency. When using SDRAM, 2-3 should be set J4 (both) Selected Device is (5000) : KS32C5000(A) , (50100) : KS32C50100 , (both) : KS32C5000 and KS32C50100 Figure C-10 : System Clock Setting C-11 KS32C50100/KS32C5000 RISC MICROCONTROLLER SETTING HDLC EXTERNAL TEST APPEDIX C SNDS100 board provides HDLC external loopback test jumper, JP5 and JP7. If you want to use external loopback, you should be jump-in JP5 and JP7 as followings. Also you can select external HDLC OSC clock by jump-in JP6. RS232C PORT B HDLC B HDLC A RS232C PORT A DCDB GND RTSB CTSB DTRB DSRB TXDB RXDB TXCB RXCB A B A B A B A B GND DCDA CTSA RTSA DSRA DTRA RXDA TXDA RXCA TXCA JP5 JP7 (a) JP5 JP7 (b) JP5 JP7 (c) JP5 JP7 JP5 JP7 (d) (a) HDLC-A channel External loop back test (From A to A channel) (b) HDLC-B channel External loop back test (From B to B channel) (c) HDLC channel A to B External loop back test (From A to B channel or B to A channel) (d) HDLC channel A to B External Test (Interface with V.24/RS-232) JP6 RXCB TXCB RXCA TXCA JP6 (a) JP6 (b) JP6 (c) (a) A-channel Tx-/Rx- clock use HDLC ExtCLK HDLC ExtCLK (b) B-channel Tx-/Rx- clock use HDLC ExtCLK (c) A-channel Rx , B-channel Rx- clock use HDLC ExtCLK Figure C-11 :HDLC External Test Setting C-12 KS32C50100/KS32C5000 RISC MICROCONTROLLER SETTING DIP SWITCH FOR SYSTEM CONFIGURATION APPEDIX C SNDS100 board provides Big-/Little- Endian mode with KS32C50100 and supports Byte/Half Word/ Word width bus access. You can choose one of these modes by setting S6 dip switch. (see Table C5 and Table C-6) S6 S6.1 S6.2 S6.3 S6.4 B0SIZE[1] B0SIZE[0] LITTLE NC(Not used) Figure C-12 : System Configuration Switch Table C-5 ROM Data Bus Size Setting Function S6.(1,2) ON, ON ON, OFF B0SIZE[1:0] OFF, ON OFF, OFF "10" "11" Half-word Word Value "00" "01" Reserved Byte Description Table C-6 Endian mode Setting Function LITTLE OFF "0 Big endian mode S6.3 ON Value "1 Description Little endian mode (Only for KS32C50100) In case of KS32C5000, this switch should be set to Big Endian mode SETTING PLL SELECTION SNDS100 provides PLL bias for KS32C50100. In case of KS32C5000, these 3 pin are mapped to CPU mode(CPUMP[2:0]). JP9 JP9 (a) KS32C50100 (b) KS32C5000 Figure C-13 : PLL selection for KS32C50100 C-13 KS32C50100/KS32C5000 RISC MICROCONTROLLER Setting UCLK You can select UCLK by setting J11. APPEDIX C J11 (a) Ext UCLK enable J11 (b) UCLK diable Figure C-14 : UCLK selection Setting SRAM/EXT I/O CHIP SELECTION(JP8) SNDS100 provides jumpers for the ROM or External I/O banks by using SRAM (One bank should be enabled) - RS1 ~ RS5 : ROM bank selection jumper - ES0 ~ ES3 : External I/O bank selection jumper Setting SDRAM/DRAM CHIP SELECTION(JP1,JP2) SNDS100 provides jumpers for SDRAM and DRAM (One bank should be enabled) - SDRAM mode : Enable a Sync DRAM bank and remove same DRAM bank jumper - DRAM mode : Enable a DRAM bank and remove same Sync DRAM bank jumper Setting MII INTERFACE JUMPER (J3-1,J3-2) These jumpers should be always Enabled for MAC evaluation. For another PHY chip, user can use a daughter board using these jumper lines. C-14 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C STATUS LED FOR KS32C50100 MODE The SNDS100 has many status LED for testing. The various LED function are as follows; Power Supply Status LED Location : D26 If Power is applied to SNDS100, The LED is on. Ethernet Status LED Location : D1,D2,D3,D4,D5 Indicate the line status, operation mode, speed. Table C-7 Ethernet Status LEDs Function Activity RX TX LI COL SPEED LED D1 D2 D3 D4 D5 Description Line Status LED (indicate Full-Duplex operation) Receive data LED Transmit data LED Link integrity LED Collision detected Activity LED (indicate 100Mbps operation) C-15 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C USER-DEFINED CONTROL/STATUS The SNDS100 has four user-defined control switch and eight user-defined status LEDs. These switched and status LEDs are described below. The corresponding signals are connected to the KS32C50100(KS32 C5000) 's general I/O ports Communication is controlled by user software. KS32C50100 P[0] P[1] P[2] General I/O Port P[3] P[4] P[5] P[6] P[7] P0 (D6) P1 (D7) P2 (D8) P3 (D9) P4 (D10) P5 (D11) P6 (D12) P7 (D13) P[8]/XINTREQ[0] P[9]/XINTREQ[1] P[10]/XINTREQ[2] P[11]/XINTREQ[3] EINT0 (SW1) EINT1 (SW2) EINT2 (SW3) EINT3 (SW4) Figure C-15 User-Defined Control Switch and Status LEDs C-16 KS32C50100/KS32C5000 RISC MICROCONTROLLER EXAMPLE OF SNDS100 CONFIGURATION SETTING An example of typical SNDS100 setting is shown below. In Case Of KS50100 Table C-8 Sample Configuration Setting Function Switch SYS PWR APPEDIX C Switch ON/OFF and Jumper J5,J6,J7,J8 : 2-3 J2 : 2-3 Description 3.3V MCU Power MCLK is generated from PLL sourced by external OSC and MCLKO enabled. SYS CLK J3 : 2-3 J4 : 1-2 HDLC TEST B0SIZE[1:0] LITTLE PLL SELECTION UCLK SRAM/EXT I/O SDRAM see P1-12 (d) JP6 : TXCA 1-2 S6.(1,2 ) : ON, OFF S6.(3) : ON, OFF JP9 : all connected JP11 : 1-2 JP8 : one connected JP1 : one connected V.24(RS-232) Interface. Byte boot ROM data bus size Little/Big Endian mode PLL bias supplied. External UCLK enalbed SRAM/EXT I/O chip selected SDRAM chip selected In Case Of KS5000 Table C-9 Sample Configuration Setting function Switch SYS PWR Switch ON/OFF and Jumper J5,J6,J7,J8 : 1-2 J2 : 2-3 Description 3.3V MCU Power External OSC is used for MCLK and MCLKO disabled. SYS CLK J3 : 2-3 J4 : not connected HDLC TEST B0SIZE[1:0] LITTLE PLL SELECTION UCLK SRAM/EXT I/O DRAM see P1-12 (d) JP6 : TXCA 1-2 S6.(1,2 ) : ON, OFF S6.(3) : OFF(Fixed) JP9 : all not connected JP11 : 1-2 JP8 : one connected JP2 : one connected V.24(RS-232) Interface. Byte boot ROM data bus size Big Endian mode PLL bias supplied. External UCLK enalbed SRAM/EXT I/O chip selected DRAM chip selected C-17 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C C.4 THE SNDS100 PROGRAMMER's MODEL BASIC OVERVIEW SNDS100 board is an implementation of an example KS32C50100 system. This board is platform which is suitable for code development of KS32C50100 -based system. For purpose of documentation, the following SNDS100 board configuration is assumed ; Boot ROM : 8-bit data bus size, two 215K/1M bit EEPROM, ROM bank 0 is used. DRAM : 4MB, one bank is used Consol Port : UART port-A Ethernet Interface : MII interface configuration, 10/100-Mbps configuration is auto-negotiated. Two-serial communication ports EmbeddedICE used as the debugging system. The sample SNDS100 board configuration method is descrived in Table C-8 and Table C-9. C-18 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C MEMORY SYSTEM SNDS100 board has two ROM sockets: for 8-bit,16-bit, and for 32-bit ROM data bus width. The ROM data bus size is configured by the B0SIZE[1:0] configuration switch. Two DRAM SIMM socket and two SDRAM are provided and one 4MB DRAM is used for code development. The KS32C50100 has total 16-M words memory region. The size and location of each memory bank can be determined by special register setting. There is one system configuration register in the system manager of KS32C50100 that is used for dermines the start address of the special register address, start address of the internal SRAM, Write-buffer enable, Cache enable, and Stall enable. The special register domain of system memory map is fixed as 64K bytes. and this register's initial value is 7FFFF90h(but 3 FFF90h for KS32C5000). You can use the internal 8-Kbyte SRAM as a cache. You configurable this space using the cache mode (CM) bit. If part of 8-Kbyte area is not used as a cache, it can be used as internal local SRAM. This area is according to the address in the base pointer of the internal SRAM field. This SRAM area is available for special purpose use. For example, you can build an interrupt vector table in the SRAM. A non-cachable area is controlled by address[26], if address[26] is "0" and the address corresponds to a ROM/SRAM/External I/O bank, it means that the accessed data is cacheable. And if the address[26] is "1" or the address is corresponds to special register or internal SRAM, the accessed data is non-cacheable. SYSTEM SPACE Unused Special 0x3FF_0000 0x3FE_0000 Register Internal SRAM DRAM0(4MB) Unused External I/O Data Area 0x140_0000 0x360_0000 Bank0 Unused DRAM1 Stack Area Code Area (Application PGM) 0x100_0050 Exception Handler Vector Table 0x100_0000 0x140_0000 (if used) DRAM0 0x100_0000 (4Mbyte) Unused ROM0 0x000_0000 Figure C-16 Main Memory MAP C-19 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C DRAM AREA STRUCTURE The SNDS100 memory allocation table is configured by Compiler, Figure C-16 shows the structure of the DRAM bank 0 area. Data Area Structure (Configured by Compiler) DRAM0(4MB) 0x140_0000 R/W Area (1 MB) Data Area (2 MB) Stack Area Code Area Heap Base Heap End Reserved User Stack Heap Area Zero Initialized Global Variable Non-Zero Initialized 0x130_0000 Image$$RW$$Limit = Image$$ZI$$Limit Image$$ZI$$Base (Application PGM) 0x100_0050 Exception Handler 0x100_0000 Vector Table Global Variable Image$$RW$$Base Figure C-17 DRAM Area Structure C-20 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C WRITING A ROM CODE When a power-on or reset signal is asserted to the KS32C50100(or KS32C5000) , the KS32C50100 (or KS32C5000) access ROM code in address 0x0. The ROM code is used to initialize the system configuration and to execute a diagnostics program. The diagnostics routine is programmed in C, and contains download and execution function. The Figure C-13 shows the flow of typical boot ROM code, from a power-on or a reset, to the diagnostic routine execution. Program Start-Up (POWER-ON/RESET) Define Entry Point Setup Exception Vectors Print Message to UART Initialize Each Stack Pointer Initialize the Memory System Initialize Memory (Required by C Code) Change processor Mode/ Status(to User Mode) Run DIAG Enable Interrupt (FIQ/IRQ) Setup Exception/Interrupt Handler Table Initialize RAM variable required by Interrupt Initialize the Critical I/O devices (UART) C_Entry Point Execute B.I.T Download /Execute Programmed In ASSEMBLY Code Programmed In C Code Figure C-18 Boot ROM Code C-21 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C INTERRUPT HANDLING The KS32C50100 has seven different types of exception, as shown in Table C-10. If an Interrupt occurs, the KS32C50100 handles the interrupt according to the flow diagram shown in Figure C-18. Table C-10 Exception Handling Priorities Exception Reset Undefined Instruction SWI Prefetch Abort Data Abort IRQ FIQ Description when CPU reset pin asserted Undefined instruction User Defined Synchronous Interrupt Frefetch from illegal address Data load/store at an illegal address external interrupt pin IRQ external interrupt pin FIQ Vector Addr 0x00 0x04 0x08 0x0C 0x10 0x18 0x1C Priority 1 6 6 5 2 4 3 Interrupt Occured FIQ/IRQ Exception Generated Branch to FIQ/IRQ Handler Routine Fetch FIQ/IRQ Handler Routine entry in DRAM Branch to Interrupt Service Routine In Interrupt Service Routine - Clear Pending bit - Interrupt Service - Return (subs PC, LR, #4) - SPSR_Fiq <= CPSR - Sets the CPSR mode bits - LR <= PC ; store return Addr - set the PC to vector address - Check Interrupt Mode/Mask/Pending Register - Fetch ISR entry address in Interrupt Vector Table Figure C-19 Interrupt Handling Flow C-22 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C C.5 EMBEDDED-ICE INTERFACE You must first choose the type of debugging system you are going to use, Then, you select the communication method to be used between your host computer and target system. The Target System The target system is a flatform suitable for real-time code development. The SNDS100(Samsung NetARM Development System) is available for a target system. A KS32C50100 debugging on the SNDS100 is controlled through the JTAG port using EmbeddedICE interface. The host computer Your host computer is runs the debugger software that is included in the ARM Software Development Toolkit, Version 2.1x. The debugging system ARM offer a choice of debugging systems for your target development system : The ARMulator EmbeddedICE Angel Debug Monitor WHAT IS EMBEDDED-ICE ? The EmbeddedICE is a JTAG-based, non-intrusive, debugging system for ARM processors. EmbeddedICE provides the interface between a debugger and ARM core either on a development board using a JTAG port for communication. EmbeddedICE has the following important feature : Real-time addressing and data-dependent breakpoints(including ROM) single stepping full access to, and control of the ARM core full memory access (read and write) full I/O system access (read and write) EmbeddedICE also lets an embeded microcessor access host system peripherals such as screen display, keyboard input, and disk drive storage. EmbeddedICE is an extension to the architecture of the ARM familly of RISC processors, and make it possible for you to debug cores that have been embedded into system. It has four main components : a set of debug extensions to the ARM core The EmbeddedICE macrocell, to provide access to system-external extensions. The EmbeddedICE interface, to provide communication between the EmbeddedICE macrocell and debugger which is resident on the host computer The Debug comms channel, which is an additional communication channel over the JTAG interface between the target ARM processor and host computer C-23 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C Debugging Extension to The ARM Core The debug extensions consist of a number of scan chains around the core and some additional pins that are used to control the behavior of the core for debug process. EmbeddedICE macrocell The EmbeddedICE macrocell is the integrated on-chip logic that provides debug support for ARM cores. The EmbeddedICE macrocell is programmed in serial through the TAP(Test Access Port) controller on the ARM, via the JTAG interface. This is usually achived via the EmbeddedICE interface. The EmbeddedICE macrocell conists of two real-time watchpoint units, together with a control and status register. One or both watchpoint unit can be programmed to halt the excution of instructions by the ARM core using its BREAKPT signal. Execution is halted when a match occurs between the values programmed into the EmbeddedICE macrocell and the values currently appearing on the address bus, data bus and various control signals. Any bit can be masked to prevent it affecting the comparison. Either watch point unit can be configured to be a watch point(monitoring data accesses) or a breakpoint(monitoring instruction fetchs). EmbeddedICE interface The EmbeddedICE interface is a JTAG protocol conversion unit. This translates the debug protocol message generated by the debugger into JTAG signals that can be sent to the EmbeddedICE macrocell, and vice versa. The interface can be connected to the host computer using either the built-in serial port, or the built-in serial and parallel ports. The serial port is used for biderectional transfers, but parallel port only used to download code, Using the parallel port increase the maximum download speed with EmbeddedICE to approximately 20KB/s. This is considerably greater than using the serial ports alone, and so is the recommended method of using EmbeddedICE(host permitting). The Debug comms Channel In addition to the debugger's communication with the processor via the scan chains, a second communication channel exists using Coprocessor 0 instructions to access the EmbeddedICE macrocell register. This is called Debug Comms Channel. The Angel Debug Protocol(ADP) compatible EmbeddedICE interface has two channels that deal with data on the Debug Comms Channel. This makes it cleaner to process at both ends. It is also considerably easer to make use of the Debug Comms Channel from the host end, because the standard handler, which reads and writes data to or from a file, can be replaced. On the target, you must provide code to drive the Debug Comms Channel directly using coprocessor instructions. The Angel Debug Monotor for Window(ADW), you can open a channel viewer window that enable direct input and output via the Debug Comms Channel. C-24 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C Effect of EmbeddedICE on the debuggee Although EmbeddedICE is generally non-intrusive, there are two exceptions : When an ARM debugger is started, it attempts to find out the state of the debuggee. To do this, it halts the debuggee and inspects the state of the ARM registers. This, however, can be considered non-intrusive if the debugging session begins after the debugger has been started. Watchpoints on structures or arrays that are larger than one word may cause the debuggee to halt execution when writes occur close to the watchpointed arrea. EmbeddedICE will restart execution transparently to the user, but this may still cause problems if the application is real time. Table C-11 Summary of Embedded ICE Run control Host Communication Download speed Pre-requisites Breakpoint available in ROM, Hardware watchpoints at full processor speed. Only require JTAG interface to the ARM processor EmbeddedICE interface Unit is limited to approximately 20KB/s ARM processor must have the debug extensions(on-chip). Can be used on a target with untested memory and peripherals systems, because communication is directly with ARM processor. C-25 KS32C50100/KS32C5000 RISC MICROCONTROLLER APPEDIX C COMMUNICATING WITH EMBEDDED-ICE To setup EmbeddedICE communication, you will need the following items : Samsung NetARM Development System(SNDS100) Board EmbeddedICE Interface unit 9-pin RS-232 cable 14-way ribbon cable 25-pin parallel cable(optional) DC power supply, 7-9V, 500mA or greater (Used in EmbeddedICE unit) DC power supply, 6-9V, 850mA or greater (Used in SNDS100) Connecting the EmbeddedICE unit To communicate between the host computer and the SNDS100 board using EmbeddedICE interface : 1. Connect the serial cable between the 9-pin serial port on the EmbeddedICE interface and the serial comms port of the host PC. 2. Connect the parallel port cable between the 25-pin parallel port connector on the EmbeddedICE interface and the printer port on the host PC(This is not essential, but will speed up download.) 3. Connect the EmbeddedICE interface to an external +7 to +9V DC power supply, 500mA or greater. 4. Connect the EmbeddedICE interface unit to the SNDS100 board JTAG port using 14-way ribbon JTAG cable. 5. Power up the EmbeddedICE and press the red reset button. 6. Power up the SNDS100 board. * Note that the interface has diode protection to prevent reserved supplies from dammaging the board. For correct operation, the 2.1mm power connector should have the positive supply connected to the center pin, as shown in Figure C-15. Ground +7 to +9V (above 500 mA) Figure C-20 Power Connection C-26 A B C D E SNDS100 Board Ver1.0 (for NetARM : KS32C5000/KS32C50100) DRAM 4 ETHERNET - IEEE802.3 Physic Ethernet al Interface - PHY - Magnetic - RJ45 Adapt Side Pin er Configuration Page3 EXTERNAL - General I/O Ports - Co ntrol/Status - LCD Driver - I2C EEPROM HDLC - 2 Channel Serial Comm Port - DSUB 25 Pin Interface MCU - KS32C500/KS32C50100 0 (NetARM) - Probe Header ROM - BootROM 2 Byte Size - Configurable Byte Size - Flash ROM Support SRAM - 1 Bank SRAM 4 Byte Size SYSTEM POWER RESET CLOCK JTAG Port Control Switch - Status LED Page8 Page9 UART - 2 Channel Serial Port - One for Consol 4 - 1 Bank DRAM 72 Pin SIMM . EDO DRAM Supported - 1 Bank SDRAM Page2 SYSTEM Page4 Page5 MCU Page6 Page7 Page10 3 nRESET B0SIZE[0..1] LITTLE CLKSEL CLKOEN TMOD0 nTRST TDI TMS TCK TDO CPUMP[0..2] UCLK(TMODE1) SYSTEM.S CH HDLC TXCA RXCA TXDA RXDA nDTRA nDSRA nRTSA nCTSA nDCDA RXCB TXCB RXDB TXDB nDSRB nDTRB nCTSB nRTSB nDCDB HDLC .SCH UART UARXD0 UARXD1 UATXD0 UATXD1 nUADSR0 nUADSR1 nUADTR0 nUADTR1 UAR T.SCH ETHER NET RXD[0..3] RXDV RXCLK RXER TXCLK COL CRS nRESET MDIO MDC TXD[0..3] TXEN TXER ETHE RNET.SCH nRESET B0SIZ E[0..1] L ITTLE(SEL_10M) CLKSEL CLKOEN TMOD0 nTRST TDI TMS TCK TDO CPUMP[ 0..2] U CLK(TMODE1) ROM nRESET B0SI ZE[0..1] LITTLE CLKSEL CLKOEN TMOD0 nTRST TDI TMS TCK TDO CPUMP[ 0..2] U CLK(TMODE1) nOE nRCS[0..5] nWBE[0..3] ADDR[0..21] XDATA[0..31] nOE nRC S[0..5] n WBE[0..3] ADDR[0 ..21] XDATA[0 ..31] nOE nRCS0 n WBE[0..1] ADDR[0 ..18] XDATA[0 ..15] 3 nRCS0 ROM.SCH SRAM 2 TXCA RXCA TXDA RXDA nDTRA nDSRA nRTSA nCTSA nDCDA RXCB TXCB RXDB TXDB nDSRB nDTRB nCTSB nRTSB nDCDB TXCA RXCA TXDA RXDA nDTRA nDSRA nRTSA nCTSA nDCDA RXCB TXCB RXDB TXDB nDSRB nDTRB nCTSB nRTSB nDCDB nECS[0..3] n ECS[0..3] nOE n ECS[0..3] nRC S[1..5] n WBE[0..3] ADDR[0 ..16] XDATA[0 ..31] SRA M.SCH DRAM SDCLK(MCLKO) nDWE nRAS[0..3] nCAS[0..3] S DCLK(MCLKO) nDWE n RAS[0..3] n CAS[0..3] S DCLK(MCLKO) nDWE n RAS[0..3] n CAS[0..3] n WBE[0..3] ADDR[0 ..13] XDATA[0 ..31] 2 UARXD0 UARXD1 UATXD0 UATXD1 nUADSR0 nUADSR1 nU ADTR0 nU ADTR1 UARXD0 UARXD1 UATXD0 UATXD1 nUADSR0 nUADSR1 nUADTR0 nUADTR1 DRAM .SCH EX TERNAL nECS0 ADDR [0..1] XDATA[ 0..7] 1 R XD[0..3] RX_ DV/LINK_10M RX_CLK /RXCLK_10M RX_ERR TX_CLK/ TXCLK_10M COL/COL_1 0M C RS/CRS_10M MDIO MDC TXD[0..3] T X _ E N/TXEN_10M TX_ERR/P COMP_10M RXD[0..3] RXDV RXCLK RXER TXCLK COL CRS MDIO MDC TXD[0..3] TXEN TXER MC U.SCH P[0..7] SCL SDA EINTR[0..3] P[0..7] SCL SDA EINTR [0..3] P[0..7] SCL SDA EINTR [0..3] E XTERNAL.SCH 1 SAMSUNG ELECTRONICS CO., L Title TD. ment System) Rev 1.0 Sheet E SNDS100(Samsung NetARM Develop Size B Date: D ocument Number MA IN.SCH F riday, March 05, 1999 1 of 10 A B C D A B C D E XDATA[0 ..31] ADDR[ 0..13] 4 XDATA[0 ..31] ADDR[0 ..13] U1 ADDR0 ADDR1 ADDR2 ADDR3 ADDR4 ADDR5 ADDR6 ADDR7 ADDR8 ADDR9 ADDR10 ADDR11 ADDR12 ADDR13 23 24 25 26 29 30 31 32 33 34 22 35 21 20 16 38 CKE(n CAS2) 37 ) 18 ) 17 19 15 39 28 41 54 A0 A1 A2 A3 A4 A5 A6 A7 A8 A9 A10/AP A11 A12 BA WE CLK CKE RAS CAS CS LDQM UDQM VSS1 VSS2 VSS3 VSSQ1 VSSQ2 VSSQ3 VSSQ4 VDD1 VDD2 VDD3 VDDQ1 VDDQ2 VDDQ3 VDDQ4 DQ0 DQ1 DQ2 DQ3 DQ4 DQ5 DQ6 DQ7 DQ8 DQ9 DQ10 DQ11 DQ12 DQ13 DQ14 DQ15 NC NC/FRU 1 14 27 3 9 43 49 2 4 5 7 8 10 11 13 42 44 45 47 48 50 51 53 36 40 6 12 46 52 XDATA0 XDATA1 XDATA2 XDATA3 XDATA4 XDATA5 XDATA6 XDATA7 XDATA8 XDATA9 XDATA10 XDATA11 XDATA12 XDATA13 XDATA14 XDATA15 VDD33 U2 ADDR0 ADDR1 ADDR2 ADDR3 ADDR4 ADDR5 ADDR6 ADDR7 ADDR8 ADDR9 ADDR10 ADDR11 ADDR12 ADDR13 23 24 25 26 29 30 31 32 33 34 22 35 21 20 16 38 CKE(n CAS2) nSDRAS(nCAS0 nSDCAS(nCAS1 nSDCS nWBE2 nWBE3 37 ) 18 ) 17 19 15 39 28 41 54 A0 A1 A2 A3 A4 A5 A6 A7 A8 A9 A10/AP A11 A12 BA WE CLK CKE RAS CAS CS LDQM UDQM VSS1 VSS2 VSS3 VSSQ1 VSSQ2 VSSQ3 VSSQ4 VDD1 VDD2 VDD3 VDDQ1 VDDQ2 VDDQ3 VDDQ4 DQ0 DQ1 DQ2 DQ3 DQ4 DQ5 DQ6 DQ7 DQ8 DQ9 DQ10 DQ11 DQ12 DQ13 DQ14 DQ15 NC NC/FRU 1 14 27 3 9 43 49 2 4 5 7 8 10 11 13 42 44 45 47 48 50 51 53 36 40 6 12 46 52 XDATA16 XDATA17 XDATA18 XDATA19 XDATA20 XDATA21 XDATA22 XDATA23 XDATA24 XDATA25 XDATA26 XDATA27 XDATA28 XDATA29 XDATA30 XDATA31 VDD33 U3 ADDR0 ADDR1 ADDR2 ADDR3 ADDR4 ADDR5 ADDR6 ADDR7 ADDR8 ADDR9 ADDR10 ADDR11 nRAS nSDRAS(nCAS0 nSDCAS(nCAS1 CKE( nCAS2) T(nCAS3) nDWE 12 13 14 15 16 17 18 28 31 32 19 29 44 34 ) 40 ) 43 41 42 47 67 68 69 70 11 33 35 36 37 38 45 46 48 66 1 39 72 A0 A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 RAS0 RAS2 CAS0 CAS1 CAS2 CAS3 W PD1 PD2 PD3 PD4 NC NC NC NC NC NC NC NC NC NC GND1 GND2 GND3 DRAM_SI MM 2 VDDD 4 VDD1 VDD2 VDD3 DQ0 DQ1 DQ2 DQ3 DQ4 DQ5 DQ6 DQ7 DQ9 DQ10 DQ11 DQ12 DQ13 DQ14 DQ15 DQ16 DQ18 DQ19 DQ20 DQ21 DQ22 DQ23 DQ24 DQ25 DQ27 DQ28 DQ29 DQ30 DQ31 DQ32 DQ33 DQ34 NC 10 30 59 2 4 6 8 20 22 24 26 49 51 53 55 57 61 63 65 3 5 7 9 21 23 25 27 50 52 54 56 58 60 62 64 71 XDATA0 XDATA1 XDATA2 XDATA3 XDATA4 XDATA5 XDATA6 XDATA7 XDATA8 XDATA9 XDATA10 XDATA11 XDATA12 XDATA13 XDATA14 XDATA15 XDATA16 XDATA17 XDATA18 XDATA19 XDATA20 XDATA21 XDATA22 XDATA23 XDATA24 XDATA25 XDATA26 XDATA27 XDATA28 XDATA29 XDATA30 XDATA31 3 nSDRAS(nCAS0 nSDCAS(nCAS1 nSDCS nWBE0 nWBE1 3 KM416S 4020B KM416S 4020B nDWE SDCLK(MCLKO ) n WBE[0..3] 2 R51 R61 n WBE[0..3] 22 22 VDD33 VDD33 VDDD C1 0.1uF C2 0.1uF C3 0.1uF C4 0.1uF C5 0.1uF C6 0.1uF C7 0.1uF C8 0.1uF C9 0.1uF C10 0.1uF C11 0.1uF C12 0.1uF C13 0.1uF C14 0.1uF C15 0.1uF C16 0.1uF C17 0.1uF n RAS[0..3] nR AS[0..3] nRAS0 nRAS1 nRAS2 nRAS3 JP1 R1 1 3 5 7 2 4 6 8 22 nSDCS n CAS[0..3] n CAS[0..3] nCAS0 R2 R3 R5 22 22 22 nSDRAS(nCAS 0) 1 HEADER 4X2 1 JP2 R4 1 3 5 7 2 4 6 8 22 nRAS nCAS1 nCAS2 nSDCAS(nCAS CKE( nCAS2) 1) VDDD VCC SAMSUNG ELECTRONICS CO.LTD, . Title SNDS100 (Samsung NetARM Develop GND VSS Size B Date: D ocument Number DRAM .SCH T h u rsday, January 21, 1999 Sheet E HEADER 4X2 nCAS3 R6 22 T(nCAS3) ment System) Rev 1.0 2 of 10 A B C D A B C D E VDDD 4 VDDD C18 0.1uF R7 680 R8 680 R9 680 R10 680 R11 680 C19 0.1uF + C120 10uF 4 LEDS LEDR LEDT LEDL D1 LED D2 D3 D4 D5 LED LED LED LED : 100Mbps : Receiver : Transmitter : 1 00Mbps(Idle) 10Mbps(Link) LEDC : Collision U4 VDDD D27 LEDS LEDC LEDL LEDT LEDR 38 39 40 41 42 12 11 44 45 64 1 16 59 60 61 62 58 57 56 18 17 28 27 50 49 48 47 51 54 55 34 R20 10K 43 52 GNDD GNDO L EVELONE LEDS LEDC LEDL LEDT LEDR XI X0 MDIO MDC COL CRS nRESET L1 TXD0 TXD1 TXD2 TXD3 TXEN TXCLK TXER FIBON FIBOP FIBN FIBP RXD0 RXD1 RXD2 RXD3 RXDV RXCLK RXER PWRDWN VCCT 19 C25 22 24 C26 GNDA VCCR 26 37 C30 0.1uF GNDR F.B. 8 7 6 5 4 10 + C28 10uF L4 GNDT 0.1uF L3 VCCR F.B. R18 1K VCCT VDDD 2 VDDD VDDD VDDO MDINT RBIAS TREF TPOP TPON TRIP TRIN 9 53 2 25 20 21 23 29 30 R15 22K 1% LED GNDT J3-1 PHY_CLK MDIO MDC COL CRS nRESET TXD0 TXD1 TXD2 TXD3 1 3 5 7 9 11 13 15 17 19 21 2 4 6 8 10 12 14 16 18 20 22 R59 1K R13 49.9 1% R14 49.9 1% C21 0.1uF GNDT C20 0.1uF 3 J1 1 2 3 4 5 6 7 8 CMT CT_T TX+ TXNC CT_R RX+ RXXFATM 2-COMBO-4 RJ45 FOR ADAPTOR C22 C27 0.1uF GNDR 3 MDIO MDC COL CRS nRESET TXD[0..3] VDDD VCCT F.B. + C23 10uF L2 GNDT F.B. + C24 10uF HEADER 1 1X2 R17 100 1% J3-2 TXEN TXCLK TXER R XD[0..3] TXEN TXCLK TXER RXD0 RXD1 RXD2 RXD3 RXDV RXCLK RXER 1 3 5 7 9 11 13 15 17 19 21 2 4 6 8 10 12 14 16 18 20 22 0.1uF GNDT VCCA 0.001 uF/2KV 2 RXDV RXCLK RXER HEADER 1 1X2 GNDR MF0 MF1 MF2 MF3 MF4 TEST 31 R19 2K VDDD PHY Clock OSC 1 L5 F.B. 8 5 R21 C31 1 U5 1 4 NC GND VDD OUT 0.1uF VDDD PHY_CLK VCC SAMSUNG ELECTRONICS CO.LTD, . Title SNDS100 (Samsung NetARM Develop GND VSS Size B Date: D ocument Number ETHE RNET.SCH S a turday, January 23, 1999 Sheet E 22 OSC(2 5MHz) ment System) Rev 1.0 3 of 10 A B C D A B C D E VDDD P[0..7] 4 P[0..7] P0 D6 LED P1 D7 LED P2 D8 LED P3 D9 LED P4 D10 LED R22 330 R23 ADDR1 330 R24 330 R25 VDDD 330 R26 2 330 R27 3 330 R29 7414 330 R30 330 XDAT A[0..7] nECS0 11 U6E 10 XDATA0 XDATA1 XDATA2 XDATA3 XDATA4 XDATA5 XDATA6 XDATA7 LCDA1 LCDA0 VDDD U7 1 2 3 4 5 6 7 8 9 10 11 12 13 14 LCON14 R28 10K 1 7414 7414 ADDR0 5 7414 U6C ADDR0 6 9 7414 U6D 8 LCDA0 ADDR1 1 2 3 4 LCDA1 LC D Driver 4 U6A U6B 3 P5 D11 LED 3 nECS0 P6 D12 LED P7 D13 LED XDAT A[0..7] EINTR [0..3] EINTR [0..3] R31 EINTR0 S1 S W P U SHBUTTON 4.7K 2 R32 EINTR1 S2 S W P U SHBUTTON R33 EINTR2 S3 S W P U SHBUTTON R36 EINTR3 S4 S W P U SHBUTTON 4.7K 1 4.7K 2 U8 1 2 3 4 NC1 NC2 NC3 VSS KS24C641 VCC WP SCL SDA 8 7 6 5 4.7K C114 0.1uF VDDD VDDD 2 IIC E EPROM R34 2K R35 2K SCL SDA SCL SDA 1 1 VDDD VCC SAMSUNG ELECTRONICS CO.LTD, . Title SNDS100 (Samsung NetARM Develop ment System) Rev 1.0 Sheet E GND A B C D VSS Size B Date: D ocument Number E XTERNAL.SCH S a turday, January 16, 1999 4 of 10 A B C D E VDDD R37 680 R38 680 R39 680 R40 680 R41 680 U9 1 2 nDSRA D15 2 nRTSA D16 2 nCTSA + D17 2 nDCDA D18 TXCA RXCA TXDA RXDA nDTRA nDSRA nRTSA nCTSA nDCDA TXCA RXCA TXDA RXDA nDTRA nDSRA nRTSA nCTSA nDCDA GND JP5 1 3 5 7 9 11 13 15 17 19 2 4 6 8 10 12 14 16 18 20 TXCA RXCA TXDA RXDA nDTRA nDSRA nRTSA nCTSA nDCDA GND C34 0.1uF HDLC Serial Commun ication Port #A, #B TXCA RXCA TXDA RXDA + C32 0.1uF 3 11 12 10 9 4 5 C1+ C1T1I R1O T2I R2O C2+ C2MAX232 U10 1 nDTRA nDSRA nRTSA nCTSA C37 0.1uF 3 11 12 10 9 4 5 + C1+ C1T1I R1O T2I R2O C2+ C2MAX232 U11 HEADER 4X2 1 JP7 RXCB TXCB RXDB TXDB nDSRB nDTRB nCTSB nRTSB nDCDB RXCB TXCB RXDB TXDB nDSRB nDTRB nCTSB nRTSB GND nDCDB 1 3 5 7 9 11 13 15 17 19 2 4 6 8 10 12 14 16 18 20 RXCB TXCB RXDB TXDB nDSRB nDTRB nCTSB nRTSB GND nDCDB C42 0.1uF 3 11 12 10 9 4 5 + C1+ C1T1I R1O T2I R2O C2+ C2MAX232 U12 1 + C47 2 nDSRB D20 2 nRTSB D21 2 nCTSB D22 2 nDCDB D23 + C51 0.1uF nDTRB nDSRB nRTSB nCTSB 0.1uF 3 11 12 10 9 4 5 C1+ C1T1I R1O T2I R2O C2+ C2MAX232 VCC V+ T1O R1I T2O R2I VGND 16 2 14 13 7 8 6 15 C48 0.1uF + VDDD VCC V+ T1O R1I T2O R2I VGND 16 2 14 13 7 8 6 15 C43 0.1uF + VDDD VCC V+ T1O R1I T2O R2I VGND 16 2 14 13 7 8 6 15 C38 0.1uF + VDDD VCC V+ T1O R1I T2O R2I VGND 16 2 14 13 7 8 6 15 C33 0.1uF + VDDD VDDD 1 1 2 2 1 LED 1 LED D14 2 nDTRA C36 0.1uF GND TXDA RXDA C35 0.1uF VDDD nRTSA RXCA nCTSA nDSRA nDTRA C41 0.1uF TXCA + 1 14 2 15 3 16 4 17 5 18 6 19 7 20 8 21 9 22 10 23 11 24 12 25 13 RS232C DTE SIDE(MAIL P1A ) 1 4 2 2 2 1 LED 1 LED 1 LED 4 1 1 change RXCA, TXDA pin (DSRA : From P16) HEADER 1 0X2 JP6 1 3 5 7 2 4 6 8 C39 0.1uF C40 0.1uF + + VDDD CONNEC TOR DB25 3 3 H DLCCLK change nDSRA, nRTSA pin C46 0.1uF P1B 1 14 2 15 3 16 4 17 5 18 6 19 7 20 8 21 9 22 10 23 11 24 12 25 13 CONNEC TOR DB25 TXDB RXDB C45 0.1uF VDDD nDSRB nRTSB RXCB nCTSB + (DSRB : From P17) 0.1uF VDDD change RXCB, TXDB pin + C44 HEADER 1 0X2 1 2 R42 680 R43 680 R44 680 R45 680 R46 680 2 1 LED D19 2 nDTRB C57 0.1uF nDTRB TXCB 1 1 1 2 2 2 1 LED 1 LED 1 LED 2 C52 0.1uF VDDD + 1 2 1 LED change nDSRB, nRTSB pin U13 VDDD C49 0.1uF L6 F.B. 14 11 8 R47 22 HDLCCLK MAX232 + 1 3 11 12 10 9 4 5 C1+ C1T1I R1O T2I R2O C2+ C2VCC V+ T1O R1I T2O R2I VGND 16 2 14 13 7 8 6 15 VDDD C56 0.1uF C50 0.1uF + VDDD VCC HDLC cloc k OSC 1 C53 0.1uF C54 0.1uF U14 1 4 7 NC GND GND1 OSC VCC OUT OUT1 + C55 0.1uF SAMSUNG ELECTRONICS CO., L Title SNDS100(Samsung NetARM Develop Size B Date: D ocument Number HDLC .SCH S a turday, January 23, 1999 Sheet E GND VSS 1 + TD. ment System) Rev 1.0 5 of 10 A B C D A B C D E 4 P[0..7] EINTR[0..3] EDMAR[0..1] EDMAA[0..1] nDSRA nDSRB SCL SDA UARXD0 nUADTR0 UATXD0 nUADSR0 UARXD1 P[0..7] EINTR[0..3] EDMAR[0..1] EDMAA[0..1] nDSRA nDSRB VDD_CPU J2-1 nUADTR1 nUADSR1 RXDA TXDA nDCDA nDSRA nDTRB nRTSB nCTSB RXCB TXCB RXDV VDD_CPU RXD1 RXD3 RXCLK TXD0 U15 KS32C50100 VDD_CPU TXD2 TXER TXEN LITTLE 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 UATXD1 nDTRA nRTSA nCTSA RXCA TXCA RXDB TXDB nDCDB nDSRB CRS RXD0 RXD2 RXER COL TXD1 TXD3 TXCLK MDIO MDC 4 XDATA[0..31] XDATA[0..31] UARX D1 nUADSR 0 UATXD 0 nUADT R0 UARX D0 SDA SCL EDMAA1 EDMAA0 EDMAR 1 EDMAR 0 EINT R3 EINT R2 EINT R1 P0 XDATA31 XDATA30 XDATA29 XDATA28 XDATA27 XDATA26 XDATA25 VDD_CPU XDATA24 XDATA23 XDATA22 XDATA21 XDATA20 XDATA19 XDATA18 XDATA17 EINT R0 P7 P6 P5 P4 P3 P2 P1 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 VDD157 VSS158 XDATA17 XDATA18 XDATA19 XDATA20 XDATA21 XDATA22 XDATA23 XDATA24 VDD167 VSS168 XDATA25 XDATA26 XDATA27 XDATA28 XDATA29 XDATA30 XDATA31 P0 VDD177 VSS178 P1 P2 P3 P4 P5 P6 P7 P8/EIN TR0 VDD187 VSS188 P9/EIN TR1 P10/EINT R2 P11/EINT R3 P12/EDMAR 0 P13/EDMAR 1 P14/EDMAA0 P15/EDMAA1 P16/TIME R0 VDD197 VSS198 P17/TIME R1 SCL SDA UARX D0 nUADT R0 UATXD0 nUADSR 0 UARX D1 VDD207 VSS208 HEADER26X2 156 155 154 153 152 151 150 149 148 147 146 145 144 143 142 141 140 139 138 137 136 135 134 133 132 131 130 129 128 127 126 125 124 123 122 121 120 119 118 117 116 115 114 113 112 111 110 109 108 107 106 105 J2-2 XDATA16 XDATA15 XDATA14 XDATA13 XDATA12 XDATA11 XDATA10 XDATA9 XDATA8 XDATA7 XDATA6 CPUMP0 CPUMP2 TMS TDO TMOD0 nECS0 nECS2 nEWAIT B0SIZE0 nRCS0 SD CLK(MCLKO) 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 CPUMP1 TCK TDI nTRST UC LK(TMODE1) nECS1 nECS3 nOE B0SIZE1 CLKOEN 3 nUADTR1 UATXD1 nUADSR1 nDTRA RXDA nRTSA TXDA nCTSA nUADTR1 UATXD1 nUADSR1 nDTRA RXDA nRTSA TXDA nCTSA 3 nDCDA RXCA nSYNCA TXCA nDTRB RXDB nRTSB TXDB NDCDA RXCA nSYNCA TXCA nDTRB RXDB nRTSB TXDB nCTSB nDCDB RXCB nSYNCB TXCB CRS RXDV RXD[0..3] RXD[0..3] nCTSB nDCDB RXCB nSYNCB TXCB CRS RXDV RXD0 RXER RXCLK COL TXD[0..3] TXD[0..3] RXD1 RXD2 RXD3 RXER RXCLK COL TXD0 TXD1 TXER TXCLK TXEN MDIO LITTLE MDC 2 TXD2 TXD3 TXER TXCLK TXEN MDIO LITTLE MDC VDDD Main Clock OSC 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 VDD1 VSS2 nUADTR1 UATXD1 nUADSR1 nDTRA RXDA nRTSA TXDA nCTSA VDD11 VSS12 nDCDA RXCA nSYNCA TXCA nDTRB RXDB nRTSB TXDB VDD21 VSS22 nCTSB nDCDB RXCB nSYNCB TXCB CR S/CRS_10M RX_ DV/LINK_10M RXD 0/RXD_10M VDD31 VSS32 RXD1 RXD2 RXD3 RX_ERR RX_CL K/RXCLK_10 C OL/COL_10M T X D0/TXD_10M T X D1/LOOP_10M VDD41 VSS42 TXD2 TXD3 TX_ER R/PCOMP_10 TX_C LK/TXCLK_10 TX_ ENT/EN_10M MDIO LITTLE(NC) MDC VDD51 VSS52 NetARM KS32C50100 VSS156 VDD155 XDATA16 XDATA15 XDATA14 XDATA13 XDATA12 XDATA11 XDATA10 XDATA9 XDATA8 XDATA7 XDATA6 VSS143 VDD142 XDATA5 XDATA4 XDATA3 XDATA2 XDATA1 XDATA0 ADDR21 ADDR20 ADDR19 ADDR18 VSS131 VDD130 ADDR17 ADDR16 ADDR15 ADDR14 ADDR13 ADDR12 ADDR11 ADDR10/AP ADDR9 ADDR8 VSS119 VDD118 ADDR7 ADDR6 ADDR5 ADDR4 ADDR3 ADDR2 ADDR1 ADDR0 ExtMACK ExtMREQ nWBE3/DQM3 VSS106 VDD105 XDATA5 XDATA4 XDATA3 XDATA2 XDATA1 XDATA0 ADDR21 ADDR20 ADDR19 ADDR18 ADDR[0..21] ADDR[0..21] CLKSEL nRCS2 nRCS4 nRAS0 nRAS2 nCAS0 nCAS2 nDWE nWBE1 MCLK nRESET nRCS1 nRCS3 nRCS5 nRAS1 nRAS3 nCAS1 nCAS3 nWBE0 nWBE2 ADDR17 ADDR16 ADDR15 ADDR14 ADDR13 ADDR12 ADDR11 ADDR10 ADDR9 ADDR8 HEADER26X2 J2-3 nWBE3 EBGNT ADDR1 ADDR3 ADDR5 ADDR7 ADDR9 ADDR11 ADDR13 ADDR15 ADDR17 ADDR19 ADDR21 XDATA1 XDATA3 XDATA5 XDATA7 XDATA9 XDATA11 XDATA13 XDATA15 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 EBREQ ADDR0 ADDR2 ADDR4 ADDR6 ADDR8 ADDR10 ADDR12 ADDR14 ADDR16 ADDR18 ADDR20 XDATA0 XDATA2 XDATA4 XDATA6 XDATA8 XDATA10 XDATA12 XDATA14 XDATA16 ADDR7 ADDR6 ADDR5 ADDR4 ADDR3 ADDR2 ADDR1 ADDR0 EBGNT EBREQ nWBE3 R48 4.7K EBGNT EBREQ VSS104 VDD103 nWBE2/DQM2 nWBE1/DQM1 nWBE0/DQM0 nDWE nCAS3 nCAS2/CKE nCAS1/nSDCAS nCAS0/nSDRAS nRAS3/nSDCS3 VSS93 VDD92 nRAS2/nSDCS2 nRAS1/nSDCS1 nRAS0/nSDCS0 nRCS5 nRCS4 nRCS3 nRCS2 nRCS1 CLKSEL nRESET VSS81 MCLK VSS79 VDD78 MCLKO/SDCLK CLKOEN nRCS0 B0SIZE1 B0SIZE0 nOE nEWAIT nECS3 nECS2 nECS1 nECS0 VSS66 VDD65 UCLK(TMODE1) TMODE0 nTRST TDO TDI TMS TCK VSSA(CPUMP2) VDDA(CPUMP1) FILTER(CPUMP0) VSS54 VDD53 2 U16 1 4 7 NC GND GND1 OSC 10MHz : DPLL Clock 50MHz : Direct Clock VCC OUT OUT1 14 11 8 L7 F.B. R49 22 R50 4.7K C58 0.1uF VDD_CPU HEADER26X2 J2-4 XDATA17 XDATA19 XDATA21 XDATA23 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 XDATA18 XDATA20 XDATA22 XDATA24 XDATA26 XDATA28 XDATA30 P0 P2 P4 P6 EINTR0 EINTR2 EDMAR0 EDMAA0 nDSRA SCL UARXD0 UATXD0 UARXD1 CPUMP 0 CPUMP 1 CPUMP 2 TC K TMS TDI TDO SDCLK(MCLKO) nOE B0SIZE0 B0SIZE1 nRCS0 nRESET CLKSEL nRCS1 nRCS2 nRCS3 nRCS4 nRCS5 nRAS0 nRAS1 nRAS2 CPUMP[0..2] TCK TMS TDI TDO nTRST TMOD0 UCL K(TMODE1) nECS[0..3] nEWAIT nOE B0SIZE[0..1] CLKOEN SD CLK(MCLKO) nRESET CLKSEL 1 CPUMP[0..2] nRAS3 nCAS0 nCAS1 nCAS2 nCAS3 nDW E nWBE0 nWBE1 nWBE2 nECS0 nECS1 nECS2 nECS3 MCLK 104 103 102 101 100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 XDATA25 XDATA27 XDATA29 XDATA31 P1 P3 P5 P7 nTRST TMOD0 UCL K(TMODE1) nECS[0..3] nEWAIT nWBE[0..3] B0SIZE[0..1] CLKOEN nDWE nCAS[0..3] nRAS[0..3] nRCS[0..5] nWBE[0..3] nDWE nCAS[0..3] nRAS[0..3] nRCS[0..5] EINTR1 EINTR3 EDMAR1 EDMAA1 nDSRB SDA nUADTR0 nUADSR0 HEADER26X2 1 VDD_CPU VDDD C59 0.1uF C60 0.1uF C61 0.1uF C62 0.1uF C63 0.1uF C64 0.1uF C65 0.1uF C66 0.1uF C67 0.1uF C68 0.1uF C69 0.1uF C70 0.1uF C71 0.1uF C72 0.1uF C73 0.1uF C74 0.1uF C75 0.1uF C76 0.1uF C77 0.1uF C78 0.1uF C79 0.1uF C80 0.1uF GND VSS Size C Date: A B C D VCC SAMSUNG ELECTRONICS C O.LTD,. Title SNDS100 (Samsung NetARM Develop Docum ent Number MCU.SCH Tuesday, March 09, 1999 E ment System) Rev 1.0 Sheet 6 of 10 A B C D E Boot Flash ROM : 8/16 Bit Bus Width is Selectable ADDR[0. .18] 4 ADDR[ 0..18] 4 XDATA[0.. 15] XDATA[0.. 15] EVEN U17 ADDR0 ADDR1 ADDR2 ADDR3 ADDR4 ADDR5 ADDR6 ADDR7 ADDR8 ADDR9 ADDR10 ADDR11 ADDR12 ADDR13 ADDR14 ADDR15 ADDR16 ADDR17 ADDR18 12 11 10 9 8 7 6 5 27 26 23 25 4 28 29 3 2 30 1 22 24 31 A0 A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 A12 A13 A14 A15 A16 A17 A18 CE OE WE 29EE010 nRCS0 nRCS0 VDD 32 VDDD U18 ADDR0 ADDR1 ADDR2 ADDR3 ADDR4 ADDR5 ADDR6 ADDR7 ADDR8 ADDR9 ADDR10 ADDR11 ADDR12 ADDR13 ADDR14 ADDR15 ADDR16 ADDR17 ADDR18 C81 0.1uF 12 11 10 9 8 7 6 5 27 26 23 25 4 28 29 3 2 30 1 22 24 31 A0 A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 A12 A13 A14 A15 A16 A17 A18 CE OE WE ODD VDDD VDD 32 3 DO0 DQ1 DQ2 DQ3 DQ4 DQ5 DQ6 DQ7 13 14 15 17 18 19 20 21 XDATA0 XDATA1 XDATA2 XDATA3 XDATA4 XDATA5 XDATA6 XDATA7 VDDD DO0 DQ1 DQ2 DQ3 DQ4 DQ5 DQ6 DQ7 13 14 15 17 18 19 20 21 XDATA8 XDATA9 XDATA10 XDATA11 XDATA12 XDATA13 XDATA14 XDATA15 VDDD 3 GND 16 GND 16 C82 0.1uF 2 29EE010 2 nOE nWBE[0..1] nOE nWBE[0..1] nWBE0 nWBE1 VDDD 1 VCC 1 SAMSUNG ELECTRONICS CO.LTD,. Title SNDS100 (Samsung NetARM Development System) GND VSS Size A Date: A B C Document Number ROM.SCH Saturday, January D Rev 1.0 16, 1999 Sheet 7 E of 10 A B C D E 4 4 ADDR[ 0..16] XDATA[0 ..31] ADDR[ 0..16] XDATA[0 ..31] U19 ADDR0 ADDR1 ADDR2 ADDR3 ADDR4 ADDR5 ADDR6 ADDR7 ADDR8 ADDR9 ADDR10 ADDR11 ADDR12 ADDR13 ADDR14 ADDR15 ADDR16 CS nOE 12 11 10 9 8 7 6 5 27 26 23 25 4 28 3 31 2 22 24 29 A0 A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 A12 A13 A14 A15 A16 CS1 OE WE KM6 81000C_55(SOP) D1 D2 D3 D4 D5 D6 D7 D8 13 14 15 17 18 19 20 21 XDATA0 XDATA1 XDATA2 XDATA3 XDATA4 XDATA5 XDATA6 XDATA7 ADDR0 ADDR1 ADDR2 ADDR3 ADDR4 ADDR5 ADDR6 ADDR7 ADDR8 ADDR9 ADDR10 ADDR11 ADDR12 ADDR13 ADDR14 ADDR15 ADDR16 CS C83 0.1uF nOE 12 11 10 9 8 7 6 5 27 26 23 25 4 28 3 31 2 22 24 29 U20 A0 A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 A12 A13 A14 A15 A16 CS1 OE WE KM6 81000C_55(SOP) D1 D2 D3 D4 D5 D6 D7 D8 13 14 15 17 18 19 20 21 XDATA8 XDATA9 XDATA10 XDATA11 XDATA12 XDATA13 XDATA14 XDATA15 ADDR0 ADDR1 ADDR2 ADDR3 ADDR4 ADDR5 ADDR6 ADDR7 ADDR8 ADDR9 ADDR10 ADDR11 ADDR12 ADDR13 ADDR14 ADDR15 ADDR16 CS C84 0.1uF nOE 12 11 10 9 8 7 6 5 27 26 23 25 4 28 3 31 2 22 24 29 U21 A0 A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 A12 A13 A14 A15 A16 CS1 OE WE KM6 81000C_55(SOP) D1 D2 D3 D4 D5 D6 D7 D8 13 14 15 17 18 19 20 21 XDATA16 XDATA17 XDATA18 XDATA19 XDATA20 XDATA21 XDATA22 XDATA23 ADDR0 ADDR1 ADDR2 ADDR3 ADDR4 ADDR5 ADDR6 ADDR7 ADDR8 ADDR9 ADDR10 ADDR11 ADDR12 ADDR13 ADDR14 ADDR15 ADDR16 CS C85 0.1uF nOE 12 11 10 9 8 7 6 5 27 26 23 25 4 28 3 31 2 22 24 29 U22 A0 A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 A12 A13 A14 A15 A16 CS1 OE WE KM68 1000C_55(SOP) D1 D2 D3 D4 D5 D6 D7 D8 13 14 15 17 18 19 20 21 XDATA24 XDATA25 XDATA26 XDATA27 XDATA28 XDATA29 XDATA30 XDATA31 3 3 VDDD VDDD VCC CS2 VSS 32 30 16 VDDD VDDD VCC CS2 VSS 32 30 16 VDDD VDDD VCC CS2 VSS 32 30 16 VDDD VDDD VCC CS2 VSS 32 30 16 C86 0.1uF nOE n WBE[0..3] nOE n WBE[0..3] nWBE0 nWBE1 nWBE2 nWBE3 2 2 nRC S[1..5] nRC S[1..5] nRCS1 nRCS2 nRCS3 nRCS4 nRCS5 nECS0 nECS1 nECS2 nECS3 JP8 1 3 5 7 9 11 13 15 17 2 4 6 8 10 12 14 16 18 CS n ECS[0..3] nE CS[0..3] HEADER 9X2 1 1 VDDD VCC SAMSUNG ELECTRONICS CO.LTD, Title SNDS100 (Samsung NetARM Develop ment System) Rev 1.0 Sheet E . GND VSS Size B Date: D ocument Number SRA M.SCH S a turday, January 16, 1999 8 of 10 A B C D A B C D E VDDD Reset Logic VDDD VDDD VDDD J2 1 2 3 CON3 V DD_CPU V DD_CPU K S 3 2 C 5 0 0 0 KS32C50100 - - - - - - - - - - -----------------------------CPU MP2 VSSA CPUMP 1 VDDA CPUMP0 FILTER CPUMP[0 ..2] JP9 CPUMP2 CPUMP1 CPUMP0 TMOD0 TMOD0 D24 1N4148 4 R52 10K U6F 13 12 C87 0.1uF U23A C88 0.1uF C89 0.1uF U24A 1 2 1 3 2 7414 7414 7408 nTRST nTRST nRESET nRESET C90 +10uF/16V S5 S W P U SHBUTTON For both KS32C5000 and KS32C50100 1-2(VCC) : Chip Tes t Mode 2-3(GND) : Normal Mode ( Maybe always use Normal mode) + V DD_CPU J3 1 2 3 CON3 CLKSEL CLKSEL C PU_GND L11 F.B. C91 C92 0.01uF C93 820pF 1 3 5 2 4 6 4 HEADER 3X2 10uF (ceramic) JP 1-2 3-4 5-6 ----- --------------------------------KS32C5000 : open open ope n KS32C50100 : short sho rt short For KS32C5000 1-2 (VCC) : MCLK/2 2-3 (GND) : MCLK KS32C5000 : J5 J6 J7 J8 1-2 1-2 1-2 1-2 KS32C50100 : J5 J6 J7 J8 2-3 2-3 2-3 2-3 R53 33 JP10 2 4 6 8 10 12 14 1 3 5 7 9 11 13 nTRST TDI TMS TCK TDO R60 10K VDDD V DD_CPU VDD33 J4 1 2 3 CON3 TDI TMS TCK TDO 3 2 1 3 2 1 3 2 1 3 2 1 VDDD 3 For KS 32C50100 1-2(VCC) : External Mast er Clock 2-3(GND) : PLL out put clock VDD33 VDD33 JTAG/E-ICE Connector V DD_CPU R54 CLKOEN CLKOEN 4.7K 1 2 3 4 SW_DIP4 S6 8 7 6 5 R55 4.7K R56 4.7K B0SIZE1 B0SIZE0 LITTLE B0SIZE[0..1] 00: Reser ved(Default) 01: Byte 10: Half World(Used) 11: Word 3 B0SIZ E[0..1] B0SI ZE[0..1] LITTLE For both KS32C5000 and KS32C50100 1-2(VCC) : MCLKO output enabl e 2 -3(GND) : MCLKO output disable J5 CON3 J6 CON3 J7 CON3 J8 CON3 HEADER 7X2 When use SDRAM MCLKO shoul be enabled d SW_DIP4(3-6) ---- ---------------------------------ON : little OFF : big => Pull down internall y 2 J9 Powe r Connector Distributed Po wer Used VDDD : Main Power for Test B oard VDD33 : MCU, SDRAM only Pow er 1 UART Clock OSC VDDD 2 OVER 5V U25 L9 VCC OUT OUT1 14 F.B. 11 8 R57 22 C94 0.1uF CON1 U26 78R05 1 1N4004 VIN VDIS GND For KS32C5000 U27 (Regurator) will be remove VDDD D25 1 d VDD33 4 7 NC GND GND1 OSC J10 Heat Sink VOUT 2 S7 1 SW O N/OFF U27 78R33 VIN Heat Sink VOUT VDIS GND 2 9V Power 1 2 3 DC_JACK R58 680 J11 1 2 3 C99 0.1uF CON3 K S 3 2 C 5 0100 : 1-2 (CLK) K S 3 2 C 5 000 : 2-3(GND) 1 U CLK(TMODE1) UCL K(TMODE1) 3 4 D26 LED Power LED C98 0.1uF + C97 100uF/10V 3 4 C95 100 uF/6.3V + C96 + 1 J12 GND 100uF/16V 1 CON1 VDDD VCC SAMSUNG ELECTRONICS CO.LTD, . Title SNDS100 (Samsung NetARM Develop ment System) Rev 1.0 Sheet E GND A B C D VSS Size B Date: D ocument Number SYSTEM.S CH F riday, March 05, 1999 9 of 10 A B C D E VDDD VCC UART Seria Port #0, #1 l 4 GND VDDD VSS 4 U28 1 C101 0.1uF 3 11 12 10 9 4 5 + C1+ C1T1I R1O T2I R2O C2+ C2MAX232 VCC V+ T1O R1I T2O R2I VGND 16 2 14 13 7 8 6 15 VDDD C100 0.1uF P2 1 6 2 7 3 8 4 9 5 10 15 11 16 12 17 13 18 14 CONNECTOR DB9X2 UATXD0 UARXD0 UATXD1 UARXD1 UATXD0 UARXD0 UATXD1 UARXD1 C102 0.1uF + DSR RXD TXD DTR + C103 0.1uF C104 0.1uF C107 330pF C108 330pF C105 330pF C106 330pF + DSR RXD TXD DTR 3 3 VDDD U29 1 C110 0.1uF 3 11 12 10 9 4 5 + C1+ C1T1I R1O T2I R2O C2+ C2MAX232 VCC V+ T1O R1I T2O R2I VGND 16 2 14 13 7 8 6 15 VDDD C109 0.1uF nUADSR0 nU ADTR0 nUADSR1 nU ADTR1 C111 0.1uF + + C112 2 C113 0.1uF + 0.1uF C115 330pF C116 330pF C117 330pF C118 2 330pF 1 1 SAMSUNG ELECTRONICS CO.LTD, . Title SNDS100 (Samsung NetARM Develop Size B Date: A B C D ment System) Rev 1.0 Sheet E D ocument Number UAR T.SCH S a turday, January 16, 1999 10 of 10 ...
View Full Document

This document was uploaded on 10/30/2011 for the course CSE 378 380 at SUNY Buffalo.

Page1 / 397

UM_ks32c50100 - .6&5,6&0,&52&21752//(5...

This preview shows document pages 1 - 3. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online