PS7b-11Blast+prob-2

PS7b-11Blast+prob-2 - Bio D137 Human and Eukaryotic...

Info iconThis preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
1 Bio D137 Human and Eukaryotic Genetics Problem Set #7b J. L. Marsh Fall 2011 Due 11/21/11 Scoring: 6.5 points total. If you attempted an answer for each question you automatically got 0.5 points for each question. Using information from model organisms such as Drosophila to better understand human genes and their function is a very powerful tool. Familiarity with web based tools and genbank is useful to you as a scientist, as a medical practitioner and as an informed person who may want to find accurate information about genes in the future. The objective of this problem is to give you a quick tour of some of the most powerful things that GenBank can do for you. I encourage you to explore as you do this problem. In class, we discussed the two major strategies for cloning a gene, namely positional cloning and targeted cloning , and we discussed the utility of using genes described in model organisms to find important human genes. Mutations in the Drosophila patched gene exhibit a segment polarity phenotype and other defects suggestive of a role in modulating signal transduction between cells. The protein sequence is shown below. Please use this protein sequence to determine if there is a human counterpart of this protein, how related it is and whether there might be any reported mutations in this gene. Note: I have posted this sequence in a word document on the class web site so you can cut and paste it as needed. >gi|8390|emb|CAA35591.1| patched protein [Drosophila melanogaster] MDRDSLPRVPDTHGDVVDEKLFSDLYIRTSWVDAQVALDQIDKGKARGSRTAIYLRSVFQSHLETLGSSVQKHAGKVLFVAILVLST FCVGLKSAQIHSKVHQLWIQEGGGLEAELAYTQKTIGEDESATHQLLIQTTHDPNASVLHPQALLAHLEVLVKATAVKVHLYDTEWG
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Image of page 2
This is the end of the preview. Sign up to access the rest of the document.

This note was uploaded on 12/13/2011 for the course BIOSCI 137 taught by Professor Staff during the Fall '11 term at UC Irvine.

Page1 / 2

PS7b-11Blast+prob-2 - Bio D137 Human and Eukaryotic...

This preview shows document pages 1 - 2. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online