dna Lecture

dna Lecture - Chi-hua Chiu Dept. of Genetics Office Hours:...

Info iconThis preview shows pages 1–6. Sign up to view the full content.

View Full Document Right Arrow Icon
Chi-hua Chiu Dept. of Genetics Office Hours: Tuesdays, 12:45-1:45 Douglass Campus MSLC Copy of important figures (not in your book) and lecture guide will be on reserve at the MSLC.
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
DNA: The carrier of genetic information Chapter 12
Background image of page 2
DNA is a major record of evolution • DNA is the genetic material of all living organisms. • Mechanisms of DNA replication, repair are conserved in all organisms. • Genes that carry out the same function are evolutionarily conserved (e.g. Hox genes)
Background image of page 3

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
FASTA file >gi|1017778|gb|U37248.1|HSU37248 Homo sapiens alpha-mannosidase (6A8) mRNA, complete cds CCTGCCCTGGAAGCGGATCGAAGTGATGGCCCTGCCCAAACCGGGCGGGGCCCACAGCCT ACAGTGCCCAGCATGGGCTATGCTCCTGTTCCTCCCCCCACCTCACTGCAGCCCCTGCTGC CTGTGTTCGTAGTGCAAGAGACTGATGGCTCCGTGACTCTGGACAATGGCATCATCCGAG DNA structure DNA sequence can be represented as a series of four letters (A,T,C,G)
Background image of page 4
The genetic code FASTA file >gi|1017779|gb|AAC00568.1| alpha-mannosidase MALPKPGGAHSLALVTVPSMGYAPVPPPTSLQPLLPQQPVFVVQETDGSVTLDNGI VLVASGREAIAEGAVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLA SPNSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYEIQFGHL FEVWAHRWMDLSEHGFGLALLNDCKYGASVRGSILSLSLLRAPKAPDATADTGRH Protein sequences can be represented as a series of 20 letters The nucleotide sequence of a DNA coding region determines the amino acid sequence of a protein
Background image of page 5

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Image of page 6
This is the end of the preview. Sign up to access the rest of the document.

This note was uploaded on 01/18/2012 for the course BIO 101 taught by Professor Martin during the Fall '08 term at Rutgers.

Page1 / 31

dna Lecture - Chi-hua Chiu Dept. of Genetics Office Hours:...

This preview shows document pages 1 - 6. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online