lecture 7 - 7-1MCB354Lecture 7Reading in Lehninger:Chapter...

Info iconThis preview shows pages 1–18. Sign up to view the full content.

View Full Document Right Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: 7-1MCB354Lecture 7Reading in Lehninger:Chapter 3, pp. 97-106Sequencing and Chemical Synthesis of Peptides7-2CHROMATOGRAPHIC MOBILITIES OF DNP- ARE KNOWN,SO THE DERIVATIZED UNKNOWN CAN BE IDENTIFIED 7-3All groupsExcept N-terminalHave ammonium group7-4Shows up in waterphase7-57-67-7HCHROMATOGRAPHY TO IDENTIFY PTH-7-8EdmanDegradation7-9Each successive, released PTH-is applied (individually) to a column to determine its retention time7-107-11EGAAYHDFEPIDPRGASMEGAAYHDFEPIDPRGASMALIKYLIACGPMTKDCVHSDTKDCVHSDALIKYLIACGPMCOOHH2NCNBrcleavage and fragments of original peptideH2NCOOHH2NCOOHH2NCOOHnow homoserine lactone7-12The at the C-terminusof the original polypeptidecan be any .7-13EGAAYHDFEPIDPRGASMALIKYLIACGPMTKDCVHSDCOO-H3NTrypsincleavageH3NCOO-H3NCOO-H3NCOO-EGAAYHDFEPIDPRGASMALIKYLIACGPMTKDCVHSDCOO-H3N7-14+++++Examples of specific protein-cleaving agentsKNOWTHESE7-15- Endopeptidase cleavage of an oligopeptide- Edman degradation to sequence fragments- ordering of fragments...
View Full Document

This note was uploaded on 01/29/2012 for the course MCB 354 taught by Professor Spees during the Spring '09 term at University of Illinois, Urbana Champaign.

Page1 / 30

lecture 7 - 7-1MCB354Lecture 7Reading in Lehninger:Chapter...

This preview shows document pages 1 - 18. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online