Quiz2 Fall2011

Quiz2 Fall2011 - 5 _ _ _ /_ _ _/_ _ _ /_ _ _/_ _ _ /_ _ _/...

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
Quiz#2 LC710 11/07/11 name____________ Q1(2%) Given the following amino acids: EEHKMLAAYMFIMYLMLLGFAIFLTLYEDRQ Mark off the beginning and end of a hypothetical transmembrane domain. Q2(2%) Circle a stretch of 6 amino acid with the least degenerate genetic code. Q3(2%) Write out the degenerate code for that stretch of amino acid
Background image of page 1
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: 5 _ _ _ /_ _ _/_ _ _ /_ _ _/_ _ _ /_ _ _/ 3 top strand Q4(2%) Write out the code using optimization code 1 5 _ _ _ /_ _ _/_ _ _ /_ _ _/_ _ _ /_ _ _/3 top strand Q2,3: Genetic Code: 1 2 1 2 1 2 1 2 Q4: Codon Probability In two organisms...
View Full Document

This note was uploaded on 02/14/2012 for the course BIO 710L taught by Professor Goldfarb during the Fall '10 term at Iowa State.

Ask a homework question - tutors are online