Quiz2v3 - (7) AFFAKKRTSAVYNPVIYIMMN Underline 6 amino acids...

Info iconThis preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
Quiz#2 LC710 9/27/10 name____________ Q1(1pt) Given the following amino acids: ValGluGlyGlnAsnArgAlaAspLeuLysPheProSerTyrThrTrpCysHisIleMet Write out single amino acid codes : _______________________________________________ Q2(1pt) Given the following amino acids: GAVLMIFPSTNCQYWDEKHR Write out triple amino acid codes : _______________________________________________ Q3(1pt) Given the following 7 sets of amino acids: Predict how many transmembrane domains could form by circling (#’s) Remember it takes about ~ “19 hydrophobic” amino acids to pass through the membrane. Circle (#’s): (1) GFFATLGGEIEALHWSLVVLAIERYVVV (2) LNYILLNLAVADEFRVFGGFTTTLYTSL (3) FSMLAAYMFLLIMLGFAINFLTLYVTV (4) AIMGVAFTWVMALACAAVSL (5) SFVIYMFVVHFIIALRIVIFFCYG (6) MVIIMVIADFLICWELPYAGVAFYIFTH
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 2
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: (7) AFFAKKRTSAVYNPVIYIMMN Underline 6 amino acids in a row with the least degenerate codon usage. Design a degenerate oligo with an EcoR1 site (GAATTC) at the 5 end. Make sure to annotate 5 and 3 ends . Genetic Code: _____________________________________________________ MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIML GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGE NHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNN ESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV TRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV YNPVILFMMNKQSFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA* Q4(1pt) Given the following amino acids:...
View Full Document

Page1 / 2

Quiz2v3 - (7) AFFAKKRTSAVYNPVIYIMMN Underline 6 amino acids...

This preview shows document pages 1 - 2. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online