Quiz3 - . Write both oligos 5’ to 3’. Make sure to...

Info iconThis preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
Quiz#3 LC710 9/29/10 name____________ Q1(1pt) Given the following protein: Nt- MNTSFSMLAAYMFLLIMLGFAINEAAFLTLYVTVLNYILLNLAVADEFRVFGGFTAT LYTSLGFFATLGGEIEALHWSLDVLAIERYVVVAIMGVAFTWVMALACAAVSLSFV IYMFVVHFIDIALRIVEIFFCYGMVIIMVIADFLICWELPYAGVAFYIFTHAFFAKKR TSAVYNPVIYIMMN-Ct Circle the potential transmembrane domains. There are more than 1. _______________________________________________ Q2(1pt) Given the following Kyte-Doolittle hydropathy plot : Circle on the number line where transmembrane regions reside.
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
You want to PCR up this conserved protein from an unknown species. - Design a fully degenerate oligo to the underlined Nt amino acids and include an extra EcoR1 site (GAATTC) at the 5’ end. This is a top strand oligo . - Design a fully degenerate oligo to the underlined Ct amino acids and include an extra BamHI site (GGATCC) at the 5’ end. This is a bottom strand oligo
Background image of page 2
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: . Write both oligos 5’ to 3’. Make sure to annotate 5’ and 3’ ends of your two oligos . Genetic Code: _____________________________________________________ MNGTE GPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIML * Q3(3pt) Given the following protein: Oligo 1:_______________________________ Oligo 2:_______________________________ * = STOP ____________________________________________________ Q4(1pt) Given the following Gene below: Using the following list of symbols: ATG , STOP , SD , SA , 5’UTR , 3’UTR Completely label the gene below with these symbols SD: splice donor SA: splice acceptor UTR: untranslated region 5’ 3’ (1pt) Extra Credit: AATAAA is a polyA recognition site. Using an arrow show approximate position in gene above. KEY: (2pt) (1pt)...
View Full Document

This note was uploaded on 02/14/2012 for the course BIO 710L taught by Professor Goldfarb during the Fall '10 term at Iowa State.

Page1 / 2

Quiz3 - . Write both oligos 5’ to 3’. Make sure to...

This preview shows document pages 1 - 2. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online