Quiz8 - UBX: Venus FP:...

Info iconThis preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
Quiz#8 LC710 10/20/10 name___________ Q1 (3pts) :I have the UBX homeodomain sequence and want to determine ( in vivo ) the optimal binding sites. I know that TAATTG is a good in vitro binding site and know that TAAT is absolutely reguired for UBX binding. Using the two plasmids below (you may modify them at will) and a third one that you need to make, please design a clever experiment to look for the best binding sites. Red F.P. Green F.P. CMVp MCS Please add modifications to plasmids CMV is Eukaryotic promoter #1 #2 #3 is TATA minimal promoter Please write it in the form of an outline
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Q2: (2pt) Below is the UBX DNA binding portion of the protein. You want to fuse it Venus FP. : Nt-RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQ* -Ct
Background image of page 2
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: UBX: Venus FP: Nt-MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICT TGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNH YLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*-Ct Write out the -9 to +9 nucleotides around the junction 5 _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ 3 Q3: (2pt) You want to mutate Phe3 to Tyr3 in Venus FP. Briefly List two Different techniques to achieve this mutation. Which is faster A or B? A) B) Genetic Code Phe-TTC Leu-CTG Ile-ATC Met-ATG Val-GTG Ser-TCT Pro-CCC Thr-ACT Ala-GCC Tyr-TAT His-CAT Gln-CAA Asn-AAT Lys-AAA Asp-GAT Glu-GAA Cys-TCT Trp-TGG Arg-CGA Gly-GGT *(stop)-TAA...
View Full Document

Page1 / 2

Quiz8 - UBX: Venus FP:...

This preview shows document pages 1 - 2. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online