Lecture 9 NCBI Tutorial

Lecture 9 NCBI Tutorial - NCBI Tutorial Notes BSCI 410 Fall...

Info iconThis preview shows pages 1–3. Sign up to view the full content.

View Full Document Right Arrow Icon
NCBI Tutorial Notes BSCI 410 Fall 11/Liu Ch1: General introduction The National Center for Biotechnology Information (NCBI):  Established in 1988 as a national  resource for molecular biology information, NCBI creates public databases, conducts research in  computational biology, develops software tools for analyzing genome data, and disseminates biomedical  information. Explore: Pubmed: literature searches, try search for Liu, Zhongchi Protein: Search "Keratin AND Human"-- get about 1797 entries Blast: See Ch 3 Taxonomy: Click on C. elegans (how many unigenes?) Structure:  3D structure database for all nucleic acids and proteins whose shape has been  determined by X-ray crystallography or nuclear magnetic resonance. The structure database is  associated with the VAST program that allows for 3D structural comparisons among different  proteins. It also will search the database on the basis of structure. (see  Ch 4 ) Books:  search “positional cloning” (click  see 34 results ) Ch 2 Pubmed Search Dystrophin (underlying Duchenne muscular dystrophy) in Pubmed 1. Type "Dystrophin" in the search box and hit go 5575 entries-in reverse chronological order. Click on some of the entries to explore-get abstract 2. Let's call up a paper by "Hoffman, Brown and Kunkel (1987), Cell" Click "Limit" on top panel (blue ink). Choose specific date and enter "jan 1, 1987 to Dec 31,  1987" press GO Now you see the "Hoffman Brown and Kunkel". Click on the authors to get abstract, related  articles, etc. Click Link (lower right menu) to click Gene (OMIM)-get all kinds of info:  gene structure, ref,  etc. Ch3: How to use Blast (Basic Local Alignment Search Tool) Blast: the most important single software tool for searching sequence databases. Query: The sequence used to initiate searches Go to www.ncbi.nlm.nih.gov Click BLAST ( It gives you a list of different Blast ) Click on 'Protein-protein BLAST [blastp]'  1. Use INSULIN sequence from zebra fish to search  Copy following sequence in FASTA format; paste the sequence into the search box >gi|12053668|emb| CAC20109.1|insulin[Danio rerio] MAVWIQAGALLVLLVVSSVSTNPGTPQHLCGSHLVDALYLVCGPTGFFYNP 1
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
NCBI Tutorial Notes BSCI 410 Fall 11/Liu KRDVEPLLGFLPPKSAQETEVADFAFKDHAELIRKRGIVEQCCHKPCSIFELQNYCN Alternatively, you can also type the accession number in the window A short cut: search for the “LEUNIG (Arabidopsis)” in the “Protein” database, Click on  FASTA, Click on “Run BLAST” on the side bar 2. Choose database  choose nr for non-redundant-it includes one copy of each gene or protein in  several of the main databases and excludes multiple copies of each record 3. Hit the submit button
Background image of page 2
Image of page 3
This is the end of the preview. Sign up to access the rest of the document.

This note was uploaded on 04/03/2012 for the course BSCI 410 taught by Professor Staff during the Spring '08 term at Maryland.

Page1 / 6

Lecture 9 NCBI Tutorial - NCBI Tutorial Notes BSCI 410 Fall...

This preview shows document pages 1 - 3. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online