Human and cucumber the computer program first aligns

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: of cytochrome c proteins from Human and Cucumber. The computer program first aligns the sequences to find the maximum number of matching amino acids; these are indicated by the vertical bars “|”. It then counts the number of amino acids which are identical in both cytochrome c’s. Human: matches: Cucumber: GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWG | | ||| || ||||| || || |||| ||||| | ||||| ||||| || GNSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNRAVIWE Human: matches: Cucumber: EDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKAT 103 | || || ||||||||||| | | || ||||||||| || EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEAT 110 This uses the single-letter amino acid code: A = alanine G= gycine, etc. Millions of years since common ancestor. These two species come from different kingdoms (plantae and animalia) and their cytochrome c’s only have 69 out of 102 amino acids that are identical. That is, 102-69 or 33 substitutions have occurred since the two organisms last had a common ancestor. With such a large number of substitutions, it is possible that a given am...
View Full Document

Ask a homework question - tutors are online