Taknrasclvpkhgalmfwrhkqlvsdpilqkrqhilvcrnaga 2

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: s in a single polypeptide chain? 40,040 D (=40kD) (364 residues * 110 D/residue = 40,040 D) [slide 6] b. Is this weight above or below the average protein? below, the average protein size is ~400 residues, which would have an approximate weight of 44,000 D (=44kD). [slide 5, 6] 2. Three polypeptides, the sequences of which are below in their one- letter code for their amino acids, are present in a mixture: 1. TAKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAGA 2. PGYFGDEPLDVHDEPEEG 3. HPLLSAWKGMEGVGKSQSFAALIVILA Of the three, which one would migrate most slowly during chromatography through: (a) an ion- exchange resin; beads coated with positively charged groups? Peptide...
View Full Document

Ask a homework question - tutors are online