hsgvnqlggvfvggrplpdstrqkivelahsgarpcdisrilqvsngcvs

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: LGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVS ||||||||||||.|||||||||||||||||||||||||||||||||||||
 HSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVS 54
 106
 
 55 KILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRD ||||||||||||||||||||||||||.||||||:||||||||||||||||
 107 KILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRD •  The aniridia gene in humans has a sequence that is similar to the drosophila eyeless gene 104
 156
 
 •  Eye morphogenesis is under similar genetic control in vertebrates and insects 105 RLLSEGVCTNDNIPSVSSINRVLRNLASEKQQMGA--------------|||.|.|||||||||||||||||||||::|:|... 
 157 RLLQENVCTNDNIPSVSSINRVLRNLAAQKEQQSTGSGSSSTSAGNSISA 139
 206
 
 155 -----------SWGTR---PGWYPGTSVPGQPTQ---------------||..| ..||| ||:...|.. 
 307 NHQALQQHQQQSWPPRHYSGSWYP-TSLSEIPISSAPNIASVTAYASGPS 174
 355
 
 175 ------------------------------------DGCQQQE---GGGE ||.|..| |.||
 356 LAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGE 185
 405
 
 186 NTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYP |...
View Full Document

This note was uploaded on 02/10/2014 for the course CS 548 taught by Professor Asaben-hur during the Spring '12 term at Colorado State.

Ask a homework question - tutors are online