blastp on UNIPROTKB [completed] 2

0 1469 00 egm05803 332 830 1466 00 ldhal6a 332 820

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: LHBHMN -att eyrgns -ie B SHm ain NLHLB E1 V3 MWVVRSRSVAFCGACRARPNTLTVKAVSLE STPVAQVSGNLLMLPQTILGWFPSMTKEIR FSKVHKSITSGAASLKLDLLDDDLGTDQGP TEPHSVIGGVMCIILGSEAVLEKKEMLHSF TMNVSDFTNNVIAAQKERNVRVIKMSIQSH KPICKYVASLITGREGTLLQNAFLISVYPC KIVNVITVWLAPNIGGNDAFFIQLISSHWL LISPDLYAKSFKRISCLTRRLGKGHECGIG EGSVVSVIGPKLSITKPQKVKVAAEIMGTW HDSPWGNAVLDNDGDDEWNHETTYIKKYSA ILVDTSLNRIPSIKLGDEFSPIGNINIILP GSALEIKLRHVTIGYIEVLICLEGTLKKTE EALKATWINLL EHKSKLEQKK Date of job ex ec ution Running time Program Databas e Sequenc es Matrix Thres hold Filtered Gapped Max imum number of hits reported J un 9, 2013 124 s ec onds blas tp (BLASTP 2.2.28+ ) uniprotk b (Protein) generated for BLAST on May 28, 2013 36,077,064 s equenc es c ons is ting of 11,597,011,699 letters blos um62 10 fals e true 250 © 2002–2013 UniProt Cons ortium | Lic ens e & Dis c laimer | Contac t www.unipr ot.or g/bla st/unipr ot/2013060927KT1DJ5TJ 3/3...
View Full Document

This document was uploaded on 03/17/2014 for the course MCB 120L at UC Davis.

Ask a homework question - tutors are online