blastp on UNIPROTKB [completed]

0 867 20 10 1 1 1 mc74203815 342 520 868 20 10 1 1

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: c y anos phaera (s train ATCC 29371 / PCC 7437) Halothec e s p. (s train PCC 7418) (Sy nec hoc oc c us s p. (s train PCC 7418)) Cy anothec e s p. (s train PCC 7822) Cy anothec e s p. (s train PCC 8802) (Sy nec hoc oc c us s p. (s train RF2)) Mic roc oleus s p. PCC 7113 Xenoc oc c us s p. PCC 7305 Ly ngby a s p. (s train PCC 8106) (Ly ngby a aes tuarii (s train CCY9616)) Nos toc punc tiforme (s train ATCC 29133 / PCC 73102) Gloeoc aps a s p. PCC 7428 B7K2D5 B7K2D5_CYAP8 Oxidoreductase dom ain protein Cy anothec e s p. (s train PCC 8801) (Sy nec hoc oc c us s p. (s train PCC 8801 / RF-1)) I4FY51 I4FY51_MICAE Sim ilar to A0ZGQ3_NODSP Hom oserine dehydrogen... Mic roc y s tis aeruginos a PCC 9717 Job information Query s equenc e >rP28|772SN3Blvri rdcaeO=yehcsi s.(tanPC60 /Kzs)G=vRP= S= t|772P28_YY iiedn euts SSncoyts p sri C 83 aua Nbd E4 V1 MEFVTVVIGGAQREFGRSLSWNENAFDFVP SNAAPRGVTYARAVRDRQVFGSATKATGRQ QWAIDEDVITNLGIEAQGHVEPATAGKQLR SQLNPILLAIQHAAALAKVLYLLYMKLQAE KKLVHELGHARNGIEFAYTMQPPRTHQFFL GLHEILGVQIQLKGVYRSIGNAQWYHQGPV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP LVLALAEALAAGKE YDESYLVDCQCYVN Date of job ex ec ution Running time Program Databas e Sequenc es Matrix J un 9, 2013 108 s ec onds blas tp (BLASTP 2.2.28+ ) uniprotk b (Protein) generated for BLAST on May 28, 2013 36,077,064 s equenc es c ons is ting of 11,597,011,699 letters blos um62 www.unipr ot.or g/bla st/unipr ot/2013060927KSN5W AQE 2/3 6/9/13 Thres hold Filtered Gapped Max imum number of hits reported bla stp on UNI PROTKB [ c omple te d] 10 fals e true 250 © 2002–2013 UniProt Cons ortium | Lic ens e & Dis c laimer | Contac t www.unipr ot.or g/bla st/unipr ot/2013060927KSN5W AQE 3/3...
View Full Document

This document was uploaded on 03/17/2014 for the course MCB 120L at UC Davis.

Ask a homework question - tutors are online