Alignment [completed]4

0 299 lhbhmn d6ua gsdog 375gro hqi

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: :*********************** ********************* ******** LHBHMN D6_UA GSD_OG 375GRO HQI_AT 299PNR 31 ILVDTSLNRIPSIKLGDEFSPIGNINIILP 30 QBZ 0 GSALEIKLRHVTIGYIEVLICLEGTLKKTE 6 9Y2 31 ILVDTSLNRIPSIKLGDEFSPIGNINIILP 30 GSD 0 GSALEIKLRHVTIGYIEVLICLEGTLKKTE 6 375 31 ILVDTSLNRIPSIKLGDEFSPIGNINIILP 30 HQI 0 GSALEIKLRHVTIGYIEVLICLEGTLKKTE 6 299 ****************************** ****************************** LHBHMN D6_UA GSD_OG 375GRO HQI_AT 299PNR 31 EALKATWINLL 31 QBZ 6 EHKSKLEQKK 8 9Y2 31 EALKATWINLL 31 GSD 6 EHKSKLEQKK 8 375 31 EALKATWINLL 31 HQI 6 EHKSKLEQKK 8 299 *********** ********** LHBHMN D6_UA GSD_OG 375GRO HQI_AT 299PNR Bnig idn st ie Ntrl aua vrat ain Can hi Atv cie st ie Ncetd uloie bnig idn Aioai mn cd poete rpris Smlrt iiaiy Hdohbc yrpoi Ngtv eaie Pstv oiie Aihtc lpai Tn iy Aoai rmtc Cagd hre Sal ml Plr oa Bg i Srn eie Troie henn Yumyadadtoa sqecst ti ainet(nFSAfra) o a d diinl eune o hs lgmn i AT omt Add sequence and align Guide tree QBZ Hglgt MN 9Y2 LHBH A D6_U GSD ihih GRO 375 GSD_OG 375 HQI 2 9 9 T2oImP N R Hx9o_ A T aQn9y Job information Query s equenc es >pQBZ|D6_UA LlcaedhdoeaeAlk 6 O=oospesG=DA6 P= S= s|9Y2LHBHMN -att eyrgns -ie B SHm ain NLHLB E1 V3 MWVVRSRSVAFCGACRARPNTLTVKAVSLE STPVAQVSGNLLMLPQTILGWFPSMTKEIR FSKVHKSITSGAASLKLDLLDDDLGTDQGP TEPHSVIGGVMCIILGSEAVLEKKEMLHSF TMNVSDFTNNVIAAQKERNVRVIKMSIQSH KPICKYVASLITGREGTLLQNAFLISVYPC KIVNVITVWLAPNIGGNDAFFIQLISSHWL LISPDLYAKSFKRISCLTRRLGKGHECGIG EGSVVSVIGPKLSITKPQKVKVAAEIMGTW HDSPWGNAVLDNDGDDEWNHETTYIKKYSA ILVDTSLNRIPSIKLGDEFSPIGNINIILP GSALEIKLRHVTIGYIEVLICLEGTLKKTE EALKATWINLL EHKSKLEQKK >rGSD|375GROUcaatrzdpoenO=oil grlagrlaG=DA6 P= S= t|375GSD_OG nhrceie rti SGrla oil oil NLHLB E3 V1 MWVVRSRSVAFCGA...
View Full Document

This document was uploaded on 03/17/2014 for the course MCB 120L at UC Davis.

Ask a homework question - tutors are online