{[ promptMessage ]}

Bookmark it

{[ promptMessage ]}

Alignment [completed]4

Alignment [completed]4 - Alignme nt c omple te d Alignment...

Info icon This preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
6/9/13 Alignment [completed] www.uniprot.org/align/2013060927KU0HZZVY 1/2 Alignment Learn how to print this alignment in color You may add additional sequences to this alignment (in FASTA format) Add sequence and align Annotation Amino acid properties ********************* ************************************** 1 MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 Q9BYZ2 LDH6B_HUMAN 1 MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 G3S7D5 G3S7D5_GORGO 1 MSWTVPVVRASQRVSSVGANFPCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 H2Q9I9 H2Q9I9_PANTR ************************************************************ 61 FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPF 120 Q9BYZ2 LDH6B_HUMAN 61 FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPF 120 G3S7D5 G3S7D5_GORGO 61 FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPF 120 H2Q9I9 H2Q9I9_PANTR ************************************************************ 121 TKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHC 180 Q9BYZ2 LDH6B_HUMAN 121 TKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHC 180 G3S7D5 G3S7D5_GORGO 121 TKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHC 180 H2Q9I9 H2Q9I9_PANTR ************************************************************
Image of page 1

Info icon This preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
Image of page 2
This is the end of the preview. Sign up to access the rest of the document.

{[ snackBarMessage ]}

What students are saying

  • Left Quote Icon

    As a current student on this bumpy collegiate pathway, I stumbled upon Course Hero, where I can find study resources for nearly all my courses, get online help from tutors 24/7, and even share my old projects, papers, and lecture notes with other students.

    Student Picture

    Kiran Temple University Fox School of Business ‘17, Course Hero Intern

  • Left Quote Icon

    I cannot even describe how much Course Hero helped me this summer. It’s truly become something I can always rely on and help me. In the end, I was not only able to survive summer classes, but I was able to thrive thanks to Course Hero.

    Student Picture

    Dana University of Pennsylvania ‘17, Course Hero Intern

  • Left Quote Icon

    The ability to access any university’s resources through Course Hero proved invaluable in my case. I was behind on Tulane coursework and actually used UCLA’s materials to help me move forward and get everything together on time.

    Student Picture

    Jill Tulane University ‘16, Course Hero Intern