{[ promptMessage ]}

Bookmark it

{[ promptMessage ]}

Alignment [completed]4

Alignment [completed]4 - Alignme nt c omple te d Alignment...

Info iconThis preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
6/9/13 Alignment [completed] www.uniprot.org/align/2013060927KU0HZZVY 1/2 Alignment Learn how to print this alignment in color You may add additional sequences to this alignment (in FASTA format) Add sequence and align Annotation Amino acid properties ********************* ************************************** 1 MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 Q9BYZ2 LDH6B_HUMAN G3S7D5 G3S7D5_GORGO 1 MSWTVPVVRASQRVSSVGANFPCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 H2Q9I9 H2Q9I9_PANTR ************************************************************ 61 FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPF 120 121 TKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHC 180 181 KLIIVSNPVDILTYVAWKLSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILG 240 ************:****************************** **************** 241 EHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA 300 241 EHGDSSVPVWSGLNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVIATAYEIIKMKGYTSWA 300 241 EHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVIATAYEIIKMKGYTSWA 300 301 IGLSVADLTESILKNLRRIHPVSTIIKGLYGIDEEVFLSIPCILGENGITNLIKIKLTPE 360 ********************* 361 EEAHLKKSAKTLWEIQNKLKL 381 Binding site Natural variant Chain Active Nucleotide binding Similarity Hydrophobic Negative Positive Aliphatic Tiny Aromatic Charged Small
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
Image of page 2
This is the end of the preview. Sign up to access the rest of the document.

{[ snackBarMessage ]}

Page1 / 2

Alignment [completed]4 - Alignme nt c omple te d Alignment...

This preview shows document pages 1 - 2. Sign up to view the full document.

View Full Document Right Arrow Icon bookmark
Ask a homework question - tutors are online