Alignment [completed]4

V1 mwvvrsrsvafcgacrarpntltvkavsle

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: CRARPNTLTVKAVSLE STPVAQVSGNLLMLPQTILGWFPSMTKEIR FSKVHKSITSGAASLKLDLLDDDLGTDQGP TEPHSVIGGVMCIILGSEAVLEKKEMLHSF TMNVSDFTNNVIAAQKERNVRVIKMSIQSH KPICKYVASLITGREGTLLQNAFLISVYPC KIVNVITVWLAPNIGGNDAFFIQLISSHWL LISPDLYAKSFKRISCLTRRLGKGHECGIG EGSVVSLIGPKLSITKPQKVKVAAEIMGTW HDSPWGNAVLDNDGDDEWNHEITYIKKYSA ILVDTSLNRIPSIKLGDEFSPIGNINIILP GSALEIKLRHVTIGYIEVLICLEGTLKKTE EALKATWINLL EHKSKLEQKK >rHQI|299PNRUcaatrzdpoenO=a toldtsG=NG00118 P= S= t|299HQI_AT nhrceie rti SPn rgoye NES000799 E3 V1 MWVVRSRSVAFCGACRARPNTLTVKAVSLE STPVAQVSGNPLMLPQTILGWFPSMTKEIR FSKVHKSITSGAASLKLDLLDDDLGTDQGP TEPHSVIGGVMCIILGSEAVLEKKEMLHSF TMNVSDFTNNVIAAQKERNVRVIKMSIQSH KPICKYVASLITGREGTLLQNAFLISVYPC www.unipr ot.or g/a lign/2013060927KU0HZZVY 1/2 6/9/13 Alignme nt [ c omple te d] KIVNVITVWLAPNIGGNDAFFIQLISSHWL LISPDLYAKSFKRISCLTRRLGKGHECGIG EGSVVSVIGPKLSITKPQKVKVAAEIMGTW HDSPWGNAVLDNDGDDEWNHEITYIKKYSA ILVDTSLNRIPSIKLGDEFSPIGNINIILP GSALEIKLRHVTIGYIEVLICLEGTLKKTE EALKATWINLL EHKSKLEQKK Date of job ex ec ution Running time Identic al pos itions Identity Similar pos itions Program J un 9, 2013 56.5 s ec onds 378 99.213% 1 c lus talo Annotation Customiz e Entry Entry nam e Q9BYZ2 LDH6B_HUMAN G3S7D5 G3S7D5_GORGO H2Q9I9 H2Q9I9_PANTR Protein nam es Organism Gene nam es L-lactate dehydrogenase A-like 6B Uncharacteriz ed protein Uncharacteriz ed protein Homo s apiens (Human) Gorilla gorilla gorilla (Lowland gorilla) Pan troglody tes (Chimpanz ee) LDHAL6B LDHAL6 LDHL LDHAL6B ENSG00000171989 © 2002–2013 UniProt Cons ortium | Lic ens e & Dis c laimer | Contac t www.unipr ot.or g/a lign/2013060927KU0HZZVY 2/2...
View Full Document

This document was uploaded on 03/17/2014 for the course MCB 120L at UC Davis.

Ask a homework question - tutors are online