Alignment [completed]3

38 2 38 2 38 2 38 2 38 2 38 2 32 4 31 8 31 8 31 8 31

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: 31 8 31 8 30 7 30 7 30 7 30 7 P28 772 FU6 7K7 LAV 8E5 HP9 0I0 HPX 0C5 HPK 009 AYA 0M3 QBZ 9Y2 GHH 2H6 HQI 299 GSD 375 QBZ 9Y2 GHH 2H6 HQI 299 GSD 375 LHBHMN D6_UA GHH_AT 2H6PNR HQI_AT 299PNR GSD_OG 375GRO P28_YY 772SN3 FU6_YY 7K7SNG LAV_SN 8E59YC HP9_SN 0I09YC HPX_SN 0C59YC HPK_SN 0099YC AYA_YS 0M3LNP LHBHMN D6_UA GHH_AT 2H6PNR HQI_AT 299PNR GSD_OG 375GRO Yumyadadtoa sqecst ti ainet(nFSAfra) o a d diinl eune o hs lgmn i AT omt Add sequence and align Guide tree GHH 2H6 QBZ 9Y2 HQI 299 GSD 375 P28 772 FU6 7K7 LAV 8E5 HP9 0I0 HPX 0C5 HPK 009 AYA 0M3 GHH_AT 2H6PNR Hglgt ihih LHBHMN D6_UA H Q Ia o o y 2 9T x n m 9PNR _AT GSD_OG 375GRO P28_YY 772SN3 FU6_YY 7K7SNG LAV_SN 8E59YC HP9_SN 0I09YC HPX_SN 0C59YC HPK_SN 0099YC AYA_YS 0M3LNP Job information >rP28|772SN3Blvri rdcaeO=yehcsi s.(tanPC60 /Kzs)G=vRP= S= t|772P28_YY iiedn euts SSncoyts p sri C 83 aua Nbd E4 V1 Query SNAAPRGVTYARAVRDRQVFGSATKATGRQ s equenc es M E F V T V V I G G A Q R E F G R S L S W N E N A F D F V P QWAIDEDVITNLGIEAQGHVEPATAGKQLR SQLNPILLAIQHAAALAKVLYLLYMKLQAE KKLVHELGHARNGIEFAYTMQPPRTHQFFL GLHEILGVQIQLKGVYRSIGNAQWYHQGPV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP LVLALAEALAAGKE YDESYLVDCQCYVN >rFU6|7K7SNGBlvri rdcaeO=yehcsi s.(tanPC60 /G-)G=vRP= S= t|7K7FU6_YY iiedn euts SSncoyts p sri C 83 TS Nbd E4 V1 MEFVTVVIGGAQREFGRSLSWNENAFDFVP SNAAPRGVTYARAVRDRQVFGSATKATGRQ QWAIDEDVITNLGIEAQGHVEPATAGKQLR SQLNPILLAIQHAAALAKVLYLLYMKLQAE KKLVHELGHARNGIEFAYTMQPPRTHQFFL GLHEILGVQIQLKGVYRSIGNAQWYHQGPV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP LVLALAEALAAGKE YDESYLVDCQCYVN >rLAV|8E59YCBlvri rdcaeO=yehcsi s.PC60 G=vRP= S= t|8E5LAV_SN iiedn euts SSncoyts p C 83 Nbd E4 V1 MEFVTVVIGGAQREFGRSLSWNENAFDFVP SNAAPRGVTYARAVRDRQVFGSATKATGRQ QWAIDEDVITNLGIEAQGHVEPATAGKQLR SQLNPILLAIQHAAALAKVLYLLYMKLQAE KKLVHELGHARNGIEFAYTMQPPRTHQFFL GLHEILGVQIQLKGVYRSIGNAQWYHQGPV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP LVLALAEALAAGKE YDESYLVDCQCYVN >rHP9|0I09YCBlvri rdcaeO=yehcsi s.PC60 sbt.PCPG=vRP= S= t|0I0HP9_SN iiedn euts...
View Full Document

Ask a homework question - tutors are online