{[ promptMessage ]}

Bookmark it

{[ promptMessage ]}

Alignment [completed]3

Alignment [completed]3 - Alignme nt c omple te d Alignment...

Info icon This preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
6/9/13 Alignment [completed] www.uniprot.org/align/2013060927KTR3VVKN 1/3 Alignment Learn how to print this alignment in color Annotation Amino acid properties : . 1 --------------------------------------------------------MSEN 4 P72782 P72782_SYNY3 1 --------------------------------------------------------MSEN 4 F7UK67 F7UK67_SYNYG 1 --------------------------------------------------------MSEN 4 L8AEV5 L8AEV5_9SYNC 1 --------------------------------------------------------MSEN 4 H0PI90 H0PI90_9SYNC 1 --------------------------------------------------------MSEN 4 H0PCX5 H0PCX5_9SYNC 1 --------------------------------------------------------MSEN 4 H0P0K9 H0P0K9_9SYNC 1 ---------------------------------------------------MVPSDLSSY 9 A0YMA3 A0YMA3_LYNSP 1 MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 Q9BYZ2 LDH6B_HUMAN 1 MSWTVPVVRASQRVSSVGANFPCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 G2HHH6 G2HHH6_PANTR 1 MSWTVPVVRASQRVSSVGANFPCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 H2Q9I9 H2Q9I9_PANTR 1 MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 G3S7D5 G3S7D5_GORGO .* :*.*:*** .. * : . *: ::: . : : : :. 5 FAVATP---VRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTFGVRPQQ 61 P72782 P72782_SYNY3 5 FAVATP---VRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTFGVRPQQ 61 F7UK67 F7UK67_SYNYG 5 FAVATP---VRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTFGVRPQQ 61 L8AEV5 L8AEV5_9SYNC 5 FAVATP---VRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTFGVRPQQ 61 H0PI90 H0PI90_9SYNC 5 FAVATP---VRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTFGVRPQQ 61 H0PCX5 H0PCX5_9SYNC 5 FAVATP---VRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTFGVRPQQ 61 H0P0K9 H0P0K9_9SYNC 10 TPSTTP---IRVGIVGTGYAAQTRAETLKSDWRSQLVTLTGHTSDKTKAICQRFNVEASA 66 A0YMA3 A0YMA3_LYNSP 61 FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLK--GETMDLQHGS 118 Q9BYZ2 LDH6B_HUMAN 61 FTSEKPAHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLK--GETMDLQHGS 118 G2HHH6 G2HHH6_PANTR 61 FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLK--GETMDLQHGS 118 H2Q9I9 H2Q9I9_PANTR 61 FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLK--GETMDLQHGS 118 G3S7D5 G3S7D5_GORGO : . : :**:*:: : :* : 62 SWQ---------ALINDPEIDLVLIATIN-QLHGAIAEAAL------------------Q 93 P72782 P72782_SYNY3 62 SWQ---------ALINDPEIDLVLIATIN-QLHGAIAEAAL------------------Q 93 F7UK67 F7UK67_SYNYG 62 SWQ---------ALINDPEIDLVLIATIN-QLHGAIAEAAL------------------Q 93 L8AEV5 L8AEV5_9SYNC 62 SWQ---------ALINDPEIDLVLIATIN-QLHGAIAEAAL------------------Q 93 H0PI90 H0PI90_9SYNC 62 SWQ---------ALINDPEIDLVLIATIN-QLHGAIAEAAL------------------Q 93 H0PCX5 H0PCX5_9SYNC 62 SWQ---------ALINDPEIDLVLIATIN-QLHGAIAEAAL------------------Q 93 H0P0K9 H0P0K9_9SYNC 67 SWE---------ELVKREDVDLVVIATVN-RDHGKIVQAAL------------------E 98 A0YMA3 A0YMA3_LYNSP 119 PFTKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSP 178 Q9BYZ2 LDH6B_HUMAN 119 PFTKMPNIVCSKDYFATANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSP 178 G2HHH6 G2HHH6_PANTR 119 PFTKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSP 178 H2Q9I9 H2Q9I9_PANTR 119 PFTKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSP 178 G3S7D5 G3S7D5_GORGO * :::. *: : . :* : :: . *.. ::.:* * : .*: 94 AGKHVVLEYPLALTYAMGKKLQQLARE----KGKLLHVEHIELLGGVHQAIR------QN 143 P72782 P72782_SYNY3 94 AGKHVVLEYPLALTYAMGKKLQQLARE----KGKLLHVEHIELLGGVHQAIR------QN 143 F7UK67 F7UK67_SYNYG 94 AGKHVVLEYPLALTYAMGKKLQQLARE----KGKLLHVEHIELLGGVHQAIR------QN 143 L8AEV5 L8AEV5_9SYNC 94 AGKHVVLEYPLALTYAMGKKLQQLARE----KGKLLHVEHIELLGGVHQAIR------QN 143 H0PI90 H0PI90_9SYNC 94 AGKHVVLEYPLALTYAMGKKLQQLARE----KGKLLHVEHIELLGGVHQAIR------QN 143 H0PCX5 H0PCX5_9SYNC 94 AGKHVVLEYPLALTYAMGKKLQQLARE----KGKLLHVEHIELLGGVHQAIR------QN 143 H0P0K9 H0P0K9_9SYNC 99 NHKHVIVEYPLSLDPTEAQNLITLAQQ----QNKMLHVEHIELLGGLHNAIK------KS 148 A0YMA3 A0YMA3_LYNSP 179 HCKLIIVSNPVDILTYVAWKLSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWI 238 Q9BYZ2 LDH6B_HUMAN
Image of page 1

Info icon This preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
Image of page 2
This is the end of the preview. Sign up to access the rest of the document.

{[ snackBarMessage ]}

What students are saying

  • Left Quote Icon

    As a current student on this bumpy collegiate pathway, I stumbled upon Course Hero, where I can find study resources for nearly all my courses, get online help from tutors 24/7, and even share my old projects, papers, and lecture notes with other students.

    Student Picture

    Kiran Temple University Fox School of Business ‘17, Course Hero Intern

  • Left Quote Icon

    I cannot even describe how much Course Hero helped me this summer. It’s truly become something I can always rely on and help me. In the end, I was not only able to survive summer classes, but I was able to thrive thanks to Course Hero.

    Student Picture

    Dana University of Pennsylvania ‘17, Course Hero Intern

  • Left Quote Icon

    The ability to access any university’s resources through Course Hero proved invaluable in my case. I was behind on Tulane coursework and actually used UCLA’s materials to help me move forward and get everything together on time.

    Student Picture

    Jill Tulane University ‘16, Course Hero Intern