Alignment [completed]3

Alignment [completed]3 - Alignme nt c omple te d Alignment...

Info iconThis preview shows pages 1–3. Sign up to view the full content.

View Full Document Right Arrow Icon
6/9/13 Alignment [completed] www.uniprot.org/align/2013060927KTR3VVKN 1/3 Alignment Learn how to print this alignment in color Annotation Amino acid properties : . 1 --------------------------------------------------------MSEN 4 P72782 P72782_SYNY3 F7UK67 F7UK67_SYNYG L8AEV5 L8AEV5_9SYNC H0PI90 H0PI90_9SYNC H0PCX5 H0PCX5_9SYNC H0P0K9 H0P0K9_9SYNC 1 ---------------------------------------------------MVPSDLSSY 9 A0YMA3 A0YMA3_LYNSP 1 MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 Q9BYZ2 LDH6B_HUMAN 1 MSWTVPVVRASQRVSSVGANFPCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER 60 G2HHH6 G2HHH6_PANTR H2Q9I9 H2Q9I9_PANTR G3S7D5 G3S7D5_GORGO .* :*.*:*** . . * : . *: ::: . : : : :. 5 FAVATP---VRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTFGVRPQQ 61 10 TPSTTP---IRVGIVGTGYAAQTRAETLKSDWRSQLVTLTGHTSDKTKAICQRFNVEASA 66 61 FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLK--GETMDLQHGS 118 61 FTSEKPAHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLK--GETMDLQHGS 118 : . : :**:*:: : :* : 62 SWQ---------ALINDPEIDLVLIATIN-QLHGAIAEAAL------------------Q 93 67 SWE---------ELVKREDVDLVVIATVN-RDHGKIVQAAL------------------E 98 119 PFTKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSP 178 119 PFTKMPNIVCSKDYFATANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSP 178 * :::. *: : . :* : :: . *. . ::.:* * : .*: 94 AGKHVVLEYPLALTYAMGKKLQQLARE----KGKLLHVEHIELLGGVHQAIR------QN 143 99 NHKHVIVEYPLSLDPTEAQNLITLAQQ----QNKMLHVEHIELLGGLHNAIK------KS 148 179 HCKLIIVSNPVDILTYVAWKLSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWI 238 :*. *: : . *::*. *. . 144 LGKIGEV-------------FYARYSTIMGQNPAPQRWTYHHQQFGFPLVAALSRISRFT 190 149 IGDIGQV-------------FYARYITISPKHPAPDKWTYQHSLFGFPFSGALSRLNRLT 195 239 LGEHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTAT------------ 286 239 LGEHGDSSVPVWSGVNIAGLPLKDLNSDIGTDKDPEQWKNVHKEVIAT------------ 286 239 LGEHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVIAT------------ 286 239 LGEHGDSSVPVWSGLNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVIAT------------ 286 :. . . .: *: 191 DLFGTVQQVDAQCRFWDQPNP---EYFRACLATAYLQFNNGL------------------ 229 196 DLFGLVQTVHCQSRFWNQPTEEQTDHYKACLCTAQLQFQNGV------------------ 237 287 -------------------------AYEIIKMKGYTSWAIGLSVADLTESILKNLRRIHP 321 230 ---KAEVIYGKGEVFHQNERIFTLHGDRGTLIF-----VGETGRLIQGQTETEITVGSRR 281 238 ---LAEAVYGKGETFWQSENTFTLYGENGTLVF-----TPQQGQLIQGESSQKIEVESRR 289 322 VSTIIKGLYGIDEEVFLS--IPCILGENGITNLIKIKLTPEEEAHLKK---------SAK 370 Binding site Natural variant Chain Active site Nucleotide binding Similarity Hydrophobic Negative Positive Aliphatic Tiny Aromatic Charged Small Polar Big Serine Threonine
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
6/9/13 Alignment [completed] www.uniprot.org/align/2013060927KTR3VVKN 2/3 You may add additional sequences to this alignment (in FASTA format) Add sequence and align : :** * . . : *:.* : . : :: * : 322 VSTIIKGLYGIDEEVFLS--IPCILGENGITNLIKIKLTPEEEAHLKK---------SAK 370 Q9BYZ2 LDH6B_HUMAN G2HHH6 G2HHH6_PANTR H2Q9I9 H2Q9I9_PANTR G3S7D5 G3S7D5_GORGO *: :.: * 282 GLFRQDTEAVLDYLTTGKPLYVDLEASLYALEVADLCAQACGYKVEN------ 328 P72782 P72782_SYNY3 F7UK67 F7UK67_SYNYG L8AEV5 L8AEV5_9SYNC H0PI90 H0PI90_9SYNC H0PCX5 H0PCX5_9SYNC H0P0K9 H0P0K9_9SYNC 290 GLFAKDTQIVLEHLLHHTPLYMTASESAYTLKVADAAKQSAQIGKVVVVESLN 342 A0YMA3 A0YMA3_LYNSP 371 TLWEIQNKLKL------------------------------------------ 381 Guide tree Highlight Taxonomy Job information Query sequences >tr|P72782|P72782_SYNY3 Biliverdin reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=bvdR PE=4 SV=1 MSENFAVATPVRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTFGVRPQ QSWQALINDPEIDLVLIATINQLHGAIAEAALQAGKHVVLEYPLALTYAMGKKLQQLARE KGKLLHVEHIELLGGVHQAIRQNLGKIGEVFYARYSTIMGQNPAPQRWTYHHQQFGFPLV AALSRISRFTDLFGTVQQVDAQCRFWDQPNPEYFRACLATAYLQFNNGLKAEVIYGKGEV FHQNERIFTLHGDRGTLIFVGETGRLIQGQTETEITVGSRRGLFRQDTEAVLDYLTTGKP LYVDLEASLYALEVADLCAQACGYKVEN >tr|F7UK67|F7UK67_SYNYG Biliverdin reductase OS=Synechocystis sp. (strain PCC 6803 / GT-S) GN=bvdR PE=4 SV=1
Background image of page 2
Image of page 3
This is the end of the preview. Sign up to access the rest of the document.

{[ snackBarMessage ]}

Page1 / 3

Alignment [completed]3 - Alignme nt c omple te d Alignment...

This preview shows document pages 1 - 3. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online