Alignment [completed]3

E2 v1 mwvvrsrsvafcgacrarpntltvkavsle

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: LE STPVAQVSGNPLMLPQTILGWFPSMTKEIR FSKAHKSITSGAASLKLDLLDDDLGTDQGP TEPHSVIGGVMCIILGSEAVLEKKEMLHSF TMNVSDFTNNVIAAQKERNVRVIKMSIQSH KPICKYAASLITGREGTLLQNAFLISVYPC KIVNVITVWLAPNIGGNDAFFIQLISSHWL LISPDLYAKSFKRISCLTRRLGKGHECGIG EGSVVSVIGPKLSITKPQKVKVAAEIMGTW HDSPWGNALLDNDGDDEWNHEITYIKKYSA ILVDTSLNRIPSIKLGDEFSPIGNINIILP GSALEIKLRHVTIGYIEVLICLEGTLKKTE EALKATWINLL EHKSKLEQKK >rHQI|299PNRUcaatrzdpoenO=a toldtsG=NG00118 P= S= t|299HQI_AT nhrceie rti SPn rgoye NES000799 E3 V1 MWVVRSRSVAFCGACRARPNTLTVKAVSLE STPVAQVSGNPLMLPQTILGWFPSMTKEIR FSKVHKSITSGAASLKLDLLDDDLGTDQGP TEPHSVIGGVMCIILGSEAVLEKKEMLHSF TMNVSDFTNNVIAAQKERNVRVIKMSIQSH KPICKYVASLITGREGTLLQNAFLISVYPC KIVNVITVWLAPNIGGNDAFFIQLISSHWL LISPDLYAKSFKRISCLTRRLGKGHECGIG EGSVVSVIGPKLSITKPQKVKVAAEIMGTW HDSPWGNAVLDNDGDDEWNHEITYIKKYSA ILVDTSLNRIPSIKLGDEFSPIGNINIILP GSALEIKLRHVTIGYIEVLICLEGTLKKTE EALKATWINLL EHKSKLEQKK >rGSD|375GROUcaatrzdpoenO=oil grlagrlaG=DA6 P= S= t|375GSD_OG nhrceie rti SGrla oil oil NLHLB E3 V1 MWVVRSRSVAFCGACRARPNTLTVKAVSLE STPVAQVSGNLLMLPQTILGWFPSMTKEIR FSKVHKSITSGAASLKLDLLDDDLGTDQGP TEPHSVIGGVMCIILGSEAVLEKKEMLHSF TMNVSDFTNNVIAAQKERNVRVIKMSIQSH KPICKYVASLITGREGTLLQNAFLISVYPC KIVNVITVWLAPNIGGNDAFFIQLISSHWL LISPDLYAKSFKRISCLTRRLGKGHECGIG EGSVVSLIGPKLSITKPQKVKVAAEIMGTW HDSPWGNAVLDNDGDDEWNHEITYIKKYSA ILVDTSLNRIPSIKLGDEFSPIGNINIILP GSALEIKLRHVTIGYIEVLICLEGTLKKTE EALKATWINLL EHKSKLEQKK Date of job ex ec ution Running t im e Identic al pos itions Identity Similar pos itions Program J un 9, 2013 10.7 s ec onds 33 6.977% 85 c lus talo Annotation Customiz e Entry Entry nam e Protein nam es Organism Gene nam es P72782 F7UK67 P72782_SYNY3 F7UK67_SYNYG Biliverdin reductase Biliverdin reductase Sy nec hoc y s tis s p. (s train PCC 6803 / Kaz us a) Sy nec hoc y s tis s p. (s train PCC 6803 / GT-S) L8AEV5 L8AEV5_9SYNC Biliverdin reductase Sy nec hoc y s tis s p. PCC 6803 bvdR bvdR SYNGTS_0221 bvdR BEST7613_1573 MYO_12210 bvdR SYNPCCP_0221 bvdR SYNPCCN_0221 bvdR SYNGTI_0221 H0PI90 H0PI90_9SYNC H0PCX5 H0PCX5_9SYNC H0P0K9 H0P0K9_9SYNC Biliverdin reductase Biliverdin reductase Biliverdin reductase A0YMA3 A0YMA3_LYNSP Hom oserine dehydrogenase, NAD-binding L-lactate dehydrogenase A-like Q9BYZ2 LDH6B_HUMAN 6B L-lactate dehydrogenase A-like G2HHH6 G2HHH6_PANTR 6B H2Q9I9 H2Q9I9_PANTR Uncharacteriz ed protein Sy nec hoc y s tis s p. PCC 6803 s ubs tr. PCC-P Sy nec hoc y s tis s p. PCC 6803 s ubs tr. PCC-N Sy nec hoc y s tis s p. PCC 6803 s ubs tr. GT-I Ly ngby a s p. (s train PCC 8106) (Ly ngby a aes tuarii (s train CCY9616)) Pan troglody tes (Chimpanz ee) ENSG00000171989 G3S7D5 G3S7D5_GORGO Uncharacteriz ed protein Gorilla gorilla gorilla (Lowland gorilla) LDHAL6B Homo s apiens (Human) L8106_17262 LDHAL6B LDHAL6 LDHL Pan troglody tes (Chimpanz ee) © 2002–2013 UniProt Cons ortium | Lic ens e & Dis c laimer | Contac t www.unipr ot.or g/a lign/2013060927KTR3VVKN 3/3...
View Full Document

Ask a homework question - tutors are online