Alignment [completed] 1

11 8 11 8 11 8 11 8 11 8 11 8

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: 8 11 8 11 8 ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV ****************************** ****************************** 20 4 20 4 20 4 20 4 20 4 20 4 HPK 009 HPX 0C5 HP9 0I0 LAV 8E5 FU6 7K7 P28 772 HPK_SN 0099YC HPX_SN 0C59YC HP9_SN 0I09YC LAV_SN 8E59YC FU6_YY 7K7SNG P28_YY 772SN3 21 4 21 4 21 4 21 4 21 4 21 4 FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP ****************************** ****************************** 30 0 30 0 30 0 30 0 30 0 30 0 HPK 009 HPX 0C5 HP9 0I0 LAV 8E5 FU6 7K7 P28 772 HPK_SN 0099YC HPX_SN 0C59YC HP9_SN 0I09YC LAV_SN 8E59YC FU6_YY 7K7SNG P28_YY 772SN3 31 0 31 0 31 0 31 0 31 0 31 0 LVLALAEALAAGKE YDESYLVDCQCYVN LVLALAEALAAGKE YDESYLVDCQCYVN LVLALAEALAAGKE YDESYLVDCQCYVN LVLALAEALAAGKE YDESYLVDCQCYVN LVLALAEALAAGKE YDESYLVDCQCYVN LVLALAEALAAGKE YDESYLVDCQCYVN ************** ************** N sqec o eune antto noain (etrs faue) aalbe vial frti o hs lcl oa ainet lgmn. Aioai mn cd poete rpris 38 2 38 2 38 2 38 2 38 2 38 2 HPK 009 HPX 0C5 HP9 0I0 LAV 8E5 FU6 7K7 P28 772 Smlrt iiaiy Hdohbc yrpoi Ngtv eaie Pstv oiie Aihtc lpai Tn iy Aoai rmtc Cagd hre Sal ml Plr oa Bg i Srn eie Troie henn HPK_SN 0099YC HPX_SN 0C59YC HP9_SN 0I09YC LAV_SN 8E59YC FU6_YY 7K7SNG P28_YY 772SN3 Yumyadadtoa sqecst ti ainet(nFSAfra) o a d diinl eune o hs lgmn i AT omt Add sequence and align Guide tree Guide tree not available for alignm ent of identical sequences. Job information >rHPK|0099YCBlvr...
View Full Document

Ask a homework question - tutors are online