Alignment [completed] 1

Tanpc60 g gvrp s t7k7fu6yy iiedn euts ssncoyts p sri

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: K7FU6_YY iiedn euts SSncoyts p sri C 83 TS Nbd E4 V1 MEFVTVVIGGAQREFGRSLSWNENAFDFVP SNAAPRGVTYARAVRDRQVFGSATKATGRQ QWAIDEDVITNLGIEAQGHVEPATAGKQLR SQLNPILLAIQHAAALAKVLYLLYMKLQAE KKLVHELGHARNGIEFAYTMQPPRTHQFFL GLHEILGVQIQLKGVYRSIGNAQWYHQGPV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP LVLALAEALAAGKE YDESYLVDCQCYVN >rP28|772SN3Blvri rdcaeO=yehcsi s.(tanPC60 /Kzs)G=vRP= S= t|772P28_YY iiedn euts SSncoyts p sri C 83 aua Nbd E4 V1 MEFVTVVIGGAQREFGRSLSWNENAFDFVP SNAAPRGVTYARAVRDRQVFGSATKATGRQ QWAIDEDVITNLGIEAQGHVEPATAGKQLR SQLNPILLAIQHAAALAKVLYLLYMKLQAE KKLVHELGHARNGIEFAYTMQPPRTHQFFL GLHEILGVQIQLKGVYRSIGNAQWYHQGPV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP LVLALAEALAAGKE YDESYLVDCQCYVN Date of job ex ec ution Running t im e Identic al pos itions Identity Similar pos itions Program J un 9, 2013 10.5 s ec onds 328 100% 0 c lus talo Annotation Customiz e Entry Entry nam e Protein nam es Organism H0P0K9 H0PCX5 H0PI90 L8AEV5 F7UK67 P72782 H0P0K9_9SYNC H0PCX5_9SYNC H0PI90_9SYNC L8AEV5_9SYNC F7UK67_SYNYG P72782_SYNY3 Biliverdin Biliverdin Biliverdin Biliverdin Biliverdin Biliverdin Sy nec hoc y s tis Sy nec hoc y s tis Sy nec hoc y s tis Sy nec hoc y s tis Sy nec hoc y s tis Sy nec hoc y s tis reductase reductase reductase reductase reductase reductase Gene nam es s p. s p. s p. s p. s p. s p. PCC 6803 s ubs tr. GT-I PCC 6803 s ubs tr. PCC-N PCC 6803 s ubs tr. PCC-P PCC 6803 (s train PCC 6803 / GT-S) (s train PCC 6803 / Kaz us a) bvdR SYNGTI_0221 bvdR SYNPCCN_0221 bvdR SYNPCCP_0221 bvdR BEST7613_1573 MYO_12210 bvdR SYNGTS_0221 bvdR © 2002–2013 UniProt Cons ortium | Lic ens e & Dis c laimer | Contac t www.unipr ot.or g/a lign/2013060970968GKDSZ 2/2...
View Full Document

This document was uploaded on 03/17/2014 for the course MCB 120L at UC Davis.

Ask a homework question - tutors are online