Alignment [completed]

n sqec o eune antto noain etrs faue aalbefr vial

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: ec o eune antto noain (etrs faue) aalbefr vial o ti lcl hs oa ainet lgmn. Aioai mn cd poete rpris 38 2 38 2 38 2 38 2 38 2 38 2 32 4 P28 772 FU6 7K7 LAV 8E5 HP9 0I0 HPX 0C5 HPK 009 AYA 0M3 Smlrt iiaiy Hdohbc yrpoi Ngtv eaie Pstv oiie Aihtc lpai Tn iy Aoai rmtc Cagd hre Sal ml Plr oa Bg i Srn eie Troie henn P28_YY 772SN3 FU6_YY 7K7SNG LAV_SN 8E59YC HP9_SN 0I09YC HPX_SN 0C59YC HPK_SN 0099YC AYA_YS 0M3LNP Yumyadadtoa sqecst ti ainet(nFSAfra) o a d diinl eune o hs lgmn i AT omt Add sequence and align Guide tree P28 772 FU6 7K7 LAV 8E5 HP9 0I0 HPX 0C5 HPK 009 AYA 0M3 P28_YY 772SN3 FUihih 7Hglgt K7SNG 6_YY L A Va o o y 8 ET x n m 59YC _SN HP9_SN 0I09YC HPX_SN 0C59YC HPK_SN 0099YC AYA_YS 0M3LNP Job information www.unipr ot.or g/a lign/2013060927KSXN6N7S 1/2 6/9/13 Alignme nt [ c omple te d] >rP28|772SN3Blvri rdcaeO=yehcsi s.(tanPC60 /Kzs)G=vRP= S= t|772P28_YY iiedn euts SSncoyts p sri C 83 aua Nbd E4 V1 Query SNAAPRGVTYARAVRDRQVFGSATKATGRQ s equenc es M E F V T V V I G G A Q R E F G R S L S W N E N A F D F V P QWAIDEDVITNLGIEAQGHVEPATAGKQLR SQLNPILLAIQHAAALAKVLYLLYMKLQAE KKLVHELGHARNGIEFAYTMQPPRTHQFFL GLHEILGVQIQLKGVYRSIGNAQWYHQGPV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP LVLALAEALAAGKE YDESYLVDCQCYVN >rFU6|7K7SNGBlvri rdcaeO=yehcsi s.(tanPC60 /G-)G=vRP= S= t|7K7FU6_YY iiedn euts SSncoyts p sri C 83 TS Nbd E4 V1 MEFVTVVIGGAQREFGRSLSWNENAFDFVP SNAAPRGVTYARAVRDRQVFGSATKATGRQ QWAIDEDVITNLGIEAQGHVEPATAGKQLR SQLNPILLAIQHAAALAKVLYLLYMKLQAE KKLVHELGHARNGIEFAYTMQPPRTHQFFL GLHEILGVQIQLKGVYRSIGNAQWYHQGPV ALRSFDFTQVACFDPPYRCAALFNLAVYKE ASIRTLGVQDQRWQNEFALTYQNGKEIGGV FQEITHDGLFGTRIGTTIVSRLRDEVDLTK HNRFLGRTIVEGLQQEETGRGFQTALYTGP LVLALAEALAAGKE YDESYLVDCQCYVN >rLAV|8E59YCBlvri rdcaeO=yehcsi s.PC60 G=vRP= S= t|8E5LAV_SN iiedn e...
View Full Document

This document was uploaded on 03/17/2014 for the course MCB 120L at UC Davis.

Ask a homework question - tutors are online