Alignment [completed]

Alignment [completed] - Alignme nt c omple te d Alignment...

Info iconThis preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
6/9/13 Alignment [completed] www.uniprot.org/align/2013060927KSXN6N7S 1/2 Alignment Learn how to print this alignment in color You may add additional sequences to this alignment (in FASTA format) Add sequence and align Annotation No sequence annotation (features) available for this local alignment. Amino acid properties :*. :**:************ ***.::.* *****:: *.:. :* :.: * 1 -----MSENFAVATPVRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTF 55 P72782 P72782_SYNY3 F7UK67 F7UK67_SYNYG L8AEV5 L8AEV5_9SYNC H0PI90 H0PI90_9SYNC H0PCX5 H0PCX5_9SYNC H0P0K9 H0P0K9_9SYNC 1 MVPSDLSSYTPSTTPIRVGIVGTGYAAQTRAETLKSDWRSQLVTLTGHTSDKTKAICQRF 60 A0YMA3 A0YMA3_LYNSP *. . **: *:: ::***:***:*: ** *.:***: ***::****:* : .::* 56 GVRPQQSWQALINDPEIDLVLIATINQLHGAIAEAALQAGKHVVLEYPLALTYAMGKKLQ 115 61 NVEASASWEELVKREDVDLVVIATVNRDHGKIVQAALENHKHVIVEYPLSLDPTEAQNLI 120 **::: *:***********:*:**::.:*.**:****** ** :.***::***:*. * 116 QLAREKGKLLHVEHIELLGGVHQAIRQNLGKIGEVFYARYSTIMGQNPAPQRWTYHHQQF 175 121 TLAQQQNKMLHVEHIELLGGLHNAIKKSIGDIGQVFYARYITISPKHPAPDKWTYQHSLF 180 ***: .****:.*:***** ** *. .*.***:**. ::::***.** ***:**: ** 176 GFPLVAALSRISRFTDLFGTVQQVDAQCRFWDQPNP---EYFRACLATAYLQFNNGLKAE 232 181 GFPFSGALSRLNRLTDLFGLVQTVHCQSRFWNQPTEEQTDHYKACLCTAQLQFQNGVLAE 240 .:*****.* *.*. ***:*:.***:*. : *:****::. :* * ****** :**: ** 233 VIYGKGEVFHQNERIFTLHGDRGTLIFVGETGRLIQGQTETEITVGSRRGLFRQDTEAVL 292 241 AVYGKGETFWQSENTFTLYGENGTLVFTPQQGQLIQGESSQKIEVESRRGLFAKDTQIVL 300 ::* .***: . * *:*:*** . *:. 293 DYLTTGKPLYVDLEASLYALEVADLCAQACGYKVEN------ 328 301 EHLLHHTPLYMTASESAYTLKVADAAKQSAQIGKVVVVESLN 342 Similarity Hydrophobic Negative Positive Aliphatic Tiny Aromatic Charged Small Polar Big Serine Threonine Guide tree Highlight Taxonomy Job information
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
6/9/13 Alignment [completed] www.uniprot.org/align/2013060927KSXN6N7S 2/2 © 2002–2013 UniProt Consortium | License & Disclaimer | Contact Query sequences >tr|P72782|P72782_SYNY3 Biliverdin reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=bvdR PE=4 SV=1 MSENFAVATPVRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTFGVRPQ QSWQALINDPEIDLVLIATINQLHGAIAEAALQAGKHVVLEYPLALTYAMGKKLQQLARE KGKLLHVEHIELLGGVHQAIRQNLGKIGEVFYARYSTIMGQNPAPQRWTYHHQQFGFPLV AALSRISRFTDLFGTVQQVDAQCRFWDQPNPEYFRACLATAYLQFNNGLKAEVIYGKGEV FHQNERIFTLHGDRGTLIFVGETGRLIQGQTETEITVGSRRGLFRQDTEAVLDYLTTGKP LYVDLEASLYALEVADLCAQACGYKVEN >tr|F7UK67|F7UK67_SYNYG Biliverdin reductase OS=Synechocystis sp. (strain PCC 6803 / GT-S) GN=bvdR PE=4 SV=1
Background image of page 2
This is the end of the preview. Sign up to access the rest of the document.

{[ snackBarMessage ]}

Page1 / 2

Alignment [completed] - Alignme nt c omple te d Alignment...

This preview shows document pages 1 - 2. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online