Alignment [completed]

Alignment [completed] - Alignme nt c omple te d Alignment...

Info icon This preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
6/9/13 Alignment [completed] www.uniprot.org/align/2013060927KSXN6N7S 1/2 Alignment Learn how to print this alignment in color You may add additional sequences to this alignment (in FASTA format) Add sequence and align Annotation No sequence annotation (features) available for this local alignment. Amino acid properties :*. :**:************ ***.::.* *****:: *.:. :* :.: * 1 -----MSENFAVATPVRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTF 55 P72782 P72782_SYNY3 1 -----MSENFAVATPVRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTF 55 F7UK67 F7UK67_SYNYG 1 -----MSENFAVATPVRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTF 55 L8AEV5 L8AEV5_9SYNC 1 -----MSENFAVATPVRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTF 55 H0PI90 H0PI90_9SYNC 1 -----MSENFAVATPVRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTF 55 H0PCX5 H0PCX5_9SYNC 1 -----MSENFAVATPVRVGIVGTGYAAQRRAEVFRGDRRSQLVSFWGNSEANTAKFADTF 55 H0P0K9 H0P0K9_9SYNC 1 MVPSDLSSYTPSTTPIRVGIVGTGYAAQTRAETLKSDWRSQLVTLTGHTSDKTKAICQRF 60 A0YMA3 A0YMA3_LYNSP *. . **: *:: ::***:***:*: ** *.:***: ***::****:* : .::* 56 GVRPQQSWQALINDPEIDLVLIATINQLHGAIAEAALQAGKHVVLEYPLALTYAMGKKLQ 115 P72782 P72782_SYNY3 56 GVRPQQSWQALINDPEIDLVLIATINQLHGAIAEAALQAGKHVVLEYPLALTYAMGKKLQ 115 F7UK67 F7UK67_SYNYG 56 GVRPQQSWQALINDPEIDLVLIATINQLHGAIAEAALQAGKHVVLEYPLALTYAMGKKLQ 115 L8AEV5 L8AEV5_9SYNC 56 GVRPQQSWQALINDPEIDLVLIATINQLHGAIAEAALQAGKHVVLEYPLALTYAMGKKLQ 115 H0PI90 H0PI90_9SYNC 56 GVRPQQSWQALINDPEIDLVLIATINQLHGAIAEAALQAGKHVVLEYPLALTYAMGKKLQ 115 H0PCX5 H0PCX5_9SYNC 56 GVRPQQSWQALINDPEIDLVLIATINQLHGAIAEAALQAGKHVVLEYPLALTYAMGKKLQ 115 H0P0K9 H0P0K9_9SYNC 61 NVEASASWEELVKREDVDLVVIATVNRDHGKIVQAALENHKHVIVEYPLSLDPTEAQNLI 120 A0YMA3 A0YMA3_LYNSP **::: *:***********:*:**::.:*.**:****** ** :.***::***:*. * 116 QLAREKGKLLHVEHIELLGGVHQAIRQNLGKIGEVFYARYSTIMGQNPAPQRWTYHHQQF 175 P72782 P72782_SYNY3 116 QLAREKGKLLHVEHIELLGGVHQAIRQNLGKIGEVFYARYSTIMGQNPAPQRWTYHHQQF 175 F7UK67 F7UK67_SYNYG 116 QLAREKGKLLHVEHIELLGGVHQAIRQNLGKIGEVFYARYSTIMGQNPAPQRWTYHHQQF 175 L8AEV5 L8AEV5_9SYNC 116 QLAREKGKLLHVEHIELLGGVHQAIRQNLGKIGEVFYARYSTIMGQNPAPQRWTYHHQQF 175 H0PI90 H0PI90_9SYNC 116 QLAREKGKLLHVEHIELLGGVHQAIRQNLGKIGEVFYARYSTIMGQNPAPQRWTYHHQQF 175 H0PCX5 H0PCX5_9SYNC 116 QLAREKGKLLHVEHIELLGGVHQAIRQNLGKIGEVFYARYSTIMGQNPAPQRWTYHHQQF 175 H0P0K9 H0P0K9_9SYNC
Image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full Document Right Arrow Icon
Image of page 2
This is the end of the preview. Sign up to access the rest of the document.

{[ snackBarMessage ]}

What students are saying

  • Left Quote Icon

    As a current student on this bumpy collegiate pathway, I stumbled upon Course Hero, where I can find study resources for nearly all my courses, get online help from tutors 24/7, and even share my old projects, papers, and lecture notes with other students.

    Student Picture

    Kiran Temple University Fox School of Business ‘17, Course Hero Intern

  • Left Quote Icon

    I cannot even describe how much Course Hero helped me this summer. It’s truly become something I can always rely on and help me. In the end, I was not only able to survive summer classes, but I was able to thrive thanks to Course Hero.

    Student Picture

    Dana University of Pennsylvania ‘17, Course Hero Intern

  • Left Quote Icon

    The ability to access any university’s resources through Course Hero proved invaluable in my case. I was behind on Tulane coursework and actually used UCLA’s materials to help me move forward and get everything together on time.

    Student Picture

    Jill Tulane University ‘16, Course Hero Intern