Alignment [completed]

Tanpc80g8076 p s t0m3ayays ooeie eyrgns a idn slnba

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: t|0M3AYA_YS ooeie eyrgns, A-idn SLnba p sri C 16 NL16122 E4 V1 MPDSYPTPRGVTYATATKDRQVLGTDTACR VSLSTSTIVIGGAQRELSWSLTTHSKKIQF NESSELKEVLVAVRHKVALNKVVYLLPEQL VAAWEVRDDVITNDGIQAEHHIEPSDTANI TAQNMHEILGLNIKIDGVYRIIPHADWYHL LQQKLVHELGHAKSGIQFAYTSKPPKTQSF GPSASLRTLGVTHQRWQTETHKCCALFNVA FFGLRNLDFLQVCSFNPEQDYALTQQQGLE AYKEFQETTYEGLFPQQIGSQIVSRLADQV VGGTWSNFLGNTVTQGLQESKEERGFKTIL ELHTLMAEATKAAKSQGVVEL HLHPYTSSYLVDAQAIKVVSN Date of job ex ec ution Running t im e Identic al pos itions Identity Similar pos itions Program J un 9, 2013 29.7 s ec onds 167 48.83% 100 c lus talo Annotation Customiz e Entry Entry nam e P72782 F7UK67 P72782_SYNY3 Biliverdin reductase F7UK67_SYNYG Biliverdin reductase Protein nam es Organism Gene nam es Sy nec hoc y s tis s p. (s train PCC 6803 / Kaz us a) Sy nec hoc y s tis s p. (s train PCC 6803 / GT-S) bvdR bvdR SYNGTS_0221 bvdR BEST7613_1573 MYO_12210 bvdR SYNPCCP_0221 bvdR SYNPCCN_0221 bvdR SYNGTI_0221 L8AEV5 L8AEV5_9SYNC Biliverdin reductase Sy nec hoc y s tis s p. PCC 6803 H0PI90 H0PI90_9SYNC Biliverdin reductase H0PCX5 H0PCX5_9SYNC Biliverdin reductase H0P0K9 H0P0K9_9SYNC Biliverdin reductase Hom oserine dehydrogenase, A0YMA3 A0YMA3_LYNSP NAD-binding Sy nec hoc y s tis s p. PCC 6803 s ubs tr. PCC-P Sy nec hoc y s tis s p. PCC 6803 s ubs tr. PCC-N Sy nec hoc y s tis s p. PCC 6803 s ubs tr. GT-I Ly ngby a s p. (s train PCC 8106) (Ly ngby a aes tuarii (s train CCY9616)) L8106_17262 © 2002–2013 UniProt Cons ortium | Lic ens e & Dis c laimer | Contac t www.unipr ot.or g/a lign/2013060927KSXN6N7S 2/2...
View Full Document

Ask a homework question - tutors are online