CTCTCCCCGACAACGGAAACCGGCGCACCTATGCAGGTGAGAAACTGAAAACGGGGAGGCTGGGTGCGGGGAAGGCATCT

  • No School
  • AA 1
  • 15

This preview shows page 13 - 15 out of 15 pages.

CTCTCCCCGACAACGGAAACCGGCGCACCTATGCAGGTGAGAAACTGAAAACGGGGAGGCTGGGTGCGGGGAAGGCATCTTTTATAGTCCTATCGTCGTTCTAGAAAAAATCCATATACGTAAACGGTTCTTCACCCA ACCAGCTGGGTAGAGCTGCAAAATAGAAAAATGTAAACCGGCTGGCCTGACGGTTTCGATGGTACAAAAAGAATTGCTAAAAATAGAAACGTCTAGCAATCTTCATAGTGTCTGGATATAAAGGAAGAAAGAACAAAT TCTAAACCGTAGCCGCGCCGTCAAAAATTAGCTTCCAATTCGGGTATAAGACAAGAAATTTTTTAAAGCAGTTCGCGCAACACCCGGTTATTATTATTGTAATTATTATAATTATTATTAATTCGAACTCTTCCACATAATTT TTTTAATTGTGATTCGTCGAAGGTCAGCCGGAGTCACGTGCTTCCTGCTACGTCCTAGAGATGACGAGGAGTTAAGATGACTCGCCGAAAGAACGATTATATAGGGGGACCACAGCTTTACGGGGGAAGGAATAAAGTT GTAAAGGATGGCGGATACCAGCCAAGCTGGTGGTGTTTCGTGTAAGTCAGTGTACGTGTGAAGGCGGGACAATCAAGTCATTATACCATTTCATTGTACAGGGTGACTGTGGCACTGTTGTTTTCTGTGACCACAATGT ACTTTAACGTGAATAAAAATATCATTGCACTACA Snip an image of the top result and copy the accession number: What is the Max Score and Total score of the top result? What is the organism source of the top result? 6. Run the following protein sequence through blastp with default parameters; 13 Dr. Balan PhD Tutorial 1
Image of page 13

Subscribe to view the full document.

UNIVERSITY of HOUSTON Department of Biotechnology BTEC 4300/6304* Principles of Bioinformatics/Computational Methods in Biotechnology MESKRFIGRPRGTTPAEDELLAAVARQSPSCTAMELLERLNLPVSRSTIYRRLTEAGINIRMTMGKQSSPVKKVFKDIKDVNGCSKSEYQS STKDNIRRSNRLTSYVPILPKLTKTRTLEMLCKNIGMVIPDISEVIVVPFNHKKCAVCHCSHSQDRNPELYFFPFPKDPRRCALWAINCNRL DLFKNDIDFINKNLTLCEDHFDASQYYIYYMFSHTPLSKKHLVWNAVPTIFHVPSRPPRENYIEPSFEQYKQLNQEAHDDLQLVLLPQSPP DEGLEILPESSNGYLSDGLYNSDDDMPPLNPVCELHEINEQVNIPMNDNFDNSSTNSNRYKNMEYILNEDEFQPFSKKLRLSEGEVNCKN RFCLTEIIHSIFKQKNLLEVERCEIKSLSEKWNSLEGKKIEVENMFKLLEDDVAKLKNEFRNLQKKEIIDISDDEAQENQSLPEGIILSPLPES YFMQDKSLNINYRNNICQNSRSFNENNSHIIESSSEVIHLGQVAISRPNLPSIGRVERSDLVIGMQVIASKLSFLHSWCRAVILDALNGSQGE KLYRIRFDGKKNGGSLCTGKQLAYIDNPWVILPVGSRIVASYKNDFNELLYHAGIVAEPPKVMNNYRYLVFFDNGHAQYVKHAEIHLVC DASKEVWEDIHPDSKDFIKGYLLQYPERPMVKLQKGQIVNTEYNGAWLSAHVKEVDASLVKLEFENNHMEWIYRGSTRLAPLYIELAT AQANRLTGKFRRHNLVAKRPHQPYVEYTRGIDEPIARPTGNLVNFRKQQKEQISNFQLSDIPSRPQVAKKQTGGCIPNQNIESSARIAKKS TTQERLLYNLMNEENRDDYDSNILQSQLGHREIHMISIGKRAKFQPHKCSVVCNGDKVNEPSKYRGKNPLQIPILCGWERQVTKHRAGC RRVVFYVTPCRRRLRSIKEVNHYLWKTKSKLTIDLFCFDSCVHTFSEFSPSRILAYIPDITYGKEDVSVSCVNSLYKEFPPYVLYSNVRFPA KGVQLNLDQEFLCGCDCEDNCQDRDRCQCQQLTINATEALPSGRIPDAGYKFRRLKEPLITGIYECNSKCKCGPSCMNRVAQNGLQVRL QLFRTERKGWGIRCLDDIPQGMFICIYAGQLLTEQGANEDGHQYGDEYLAELDHIEVVERLKEGYESDVVDPEENDKEDSDDSTEDSDE SSYFDPSQKDKADSDSDFDVDFKEVVEYGCHSTRSRKKLLDVNNLSEESSINGSKANSLEKIAESCTETQISTSEKFSSTFSINDENVSLLT ADEIKVEVETDTNNADLKIVESCSDLPKTEITPILGTNLPEVKKVTVPWVPQLAEEHDKVSDIVNNNNNNDDNKNNNNNNNNNNNTSSE GKIEDESMASTSLFSNLPDPKKGPLLNTKTELRNENSQFVSVRKFFNEEYCYIMDAKNCGNIGRYLNPILDSPRPTIRQPSDEGWALYIWD Snip an image of the top result and copy the accession number: Python & BASH practice problems 14 Dr. Balan PhD Tutorial 1
Image of page 14
UNIVERSITY of HOUSTON Department of Biotechnology BTEC 4300/6304* Principles of Bioinformatics/Computational Methods in Biotechnology Done in CLASS 15 Dr. Balan PhD Tutorial 1
Image of page 15

What students are saying

  • Left Quote Icon

    As a current student on this bumpy collegiate pathway, I stumbled upon Course Hero, where I can find study resources for nearly all my courses, get online help from tutors 24/7, and even share my old projects, papers, and lecture notes with other students.

    Student Picture

    Kiran Temple University Fox School of Business ‘17, Course Hero Intern

  • Left Quote Icon

    I cannot even describe how much Course Hero helped me this summer. It’s truly become something I can always rely on and help me. In the end, I was not only able to survive summer classes, but I was able to thrive thanks to Course Hero.

    Student Picture

    Dana University of Pennsylvania ‘17, Course Hero Intern

  • Left Quote Icon

    The ability to access any university’s resources through Course Hero proved invaluable in my case. I was behind on Tulane coursework and actually used UCLA’s materials to help me move forward and get everything together on time.

    Student Picture

    Jill Tulane University ‘16, Course Hero Intern

Ask Expert Tutors You can ask 0 bonus questions You can ask 0 questions (0 expire soon) You can ask 0 questions (will expire )
Answers in as fast as 15 minutes